KEGG   Corynebacterium glutamicum R: cgR_1240
Entry
cgR_1240          CDS       T00501                                 

Name
(GenBank) hypothetical protein
  KO
K20943  resorcinol 4-hydroxylase (NADPH) [EC:1.14.13.219]
Organism
cgt  Corynebacterium glutamicum R
Pathway
cgt00362  Benzoate degradation
cgt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cgR_1240
Enzymes [BR:cgt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.219  resorcinol 4-hydroxylase (NADPH)
     cgR_1240
SSDB
Motif
Pfam: FAD_binding_3 DAO NAD_binding_8 Pyr_redox_2 FAD_binding_2 HI0933_like ApbA FAD_oxidored Pyr_redox NAD_Gly3P_dh_N Lycopene_cycl Thi4 Cellsynth_D Pyr_redox_3
Other DBs
NCBI-ProteinID: BAF54219
UniProt: A4QDC2
Position
1355867..1357459
AA seq 530 aa
MSPNNFDTDVCIVGGGPTGTLLAVLLGQKGHRVTILEKWPTFYERPRAVTFDHEIARILG
YIGIDSENDEAIDYHSDSYDWKNAAGETLLEVDWTSMTDSGWRTRYWFYQPELEKRLRDL
ALTMDFVDIRCGFTAVGLSQDENSATIHGIVTDTPENIPADAQREDIRAKYVIGADGANS
FVRNSLGLEMNDLGYFFDWLILDLKPTQDIDYGTDHWQLCDPKRPTTIVPGGPGRRRWEF
MALPGEDLKELASEESAWKLLEPWDVTPDKAVLERSAVYRFQARWAQEWRSGRALIAGDA
AHLMPPFAGEGMCAGLRDSLALAWRLDLVLSGKSDDALLDTYGEERREHVHYYIDFSMDL
GNVICITDEDEARLRDERMIKELEAQDGVPVNTDVAHLGPGIWDKDSSHGGELAKQGIVE
YQGRKARFDDAVGRGWAVLGLNTDPREVLDEDSLVALDAIGAIVESVGDATSAVLDVEGL
YTRWLKEAGATFIITRPDFYVYSTAVDAEQLQTQIKQLSDLLHLNSVVGA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtcacccaataacttcgataccgatgtctgcatcgtcggtggaggtcctaccggaacg
ctccttgcagtactgctcggccaaaaaggtcatcgcgtcaccatcctggaaaagtggcca
acattctacgaacgacctcgtgcagtcacctttgaccacgaaatcgcgcggatccttgga
tacattggcattgattctgaaaacgacgaagccatcgattaccactccgacagctacgac
tggaagaacgcagcgggggagacgcttttggaagtcgattggacctccatgacagattcc
ggatggcgcacccgatactggttctaccagccagaacttgaaaagcgtctgcgcgatctg
gccctgaccatggattttgtggatattcgctgtggcttcaccgctgtcggattgtcccaa
gatgaaaactccgccaccattcacggcattgtcactgataccccagagaacattccagca
gatgctcagcgcgaagatatccgagcgaagtatgtcatcggtgcagacggagctaacagt
ttcgtgcgtaactcccttggcttagagatgaatgatcttggatacttcttcgactggctg
attctggacctcaagccaactcaggacattgactacggaacagatcactggcaactgtgt
gatcccaagcgcccaaccaccattgttcctggaggccccggccgccgacgttgggaattc
atggcgctgcctggtgaagatctcaaggaactcgcttctgaagaaagcgcgtggaagcta
cttgagccatgggatgtcacacctgacaaggctgttctcgagcgctccgcagtgtatcga
ttccaagctcgatgggcccaagaatggcggtccggtagggctctcatcgcaggcgacgcc
gctcacctcatgccacctttcgcaggtgaaggcatgtgcgcgggcttgagagattcactg
gcgttggcatggcgtcttgatttggtgctgagcggaaaatcagatgatgcattgctagac
acctacggagaagaacgtcgtgaacacgtccactactacattgatttctccatggacctg
ggcaatgtcatctgcattactgatgaagatgaagcacgtttgcgcgatgagcgcatgatt
aaagagcttgaagcacaagacggggtccctgttaataccgatgtcgcgcacttgggaccg
ggaatttgggataaagattcttcccatggtggcgagctagcgaagcagggcatagtggaa
taccaaggtcgaaaggcgcgtttcgacgacgcagtcggccgtggctgggcagttttaggc
ctcaacactgatccacgagaagtgcttgatgaggattcgcttgtggcacttgacgccatc
ggtgcaatcgtcgaatcagtaggtgatgcaacttccgcagttttagatgttgaaggtctt
tacactcgctggctcaaggaagccggggcaacatttattattacccgccccgatttctac
gtctattccacagcagtggacgctgaacaacttcaaacacagattaagcagctatcggat
ctacttcacctcaactcagttgtcggagcatag

DBGET integrated database retrieval system