KEGG   Chromobacterium phragmitis IIBBL 274-1: DK843_06510
Entry
DK843_06510       CDS       T05744                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
chrb  Chromobacterium phragmitis IIBBL 274-1
Pathway
chrb00404  Staurosporine biosynthesis
chrb01100  Metabolic pathways
chrb01110  Biosynthesis of secondary metabolites
chrb02024  Quorum sensing
Module
chrb_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    DK843_06510
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DK843_06510
Enzymes [BR:chrb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     DK843_06510
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Pyr_redox_2 DAO NAD_binding_8 Pyr_redox GIDA SE FAD_binding_2 HI0933_like FAD_oxidored
Other DBs
NCBI-ProteinID: AXE33982
UniProt: A0A344UFD4
Position
complement(1360667..1361956)
AA seq 429 aa
MKRAIIVGGGLAGGLTAIYLAKRGYEVHVAEKRGDPLQDLSSYVDVVSSRAIGVSMTVRG
IKAVLAAGIPRQELEACGEPIVAMAFSVGGQYRMRELKPLEDFRPLSLNRAAFQKLLNKY
ANLAGVRYYFEHKCLEVDLEGKSVLIQDKDGQSLRLAGDMIIGADGAHSAVRQAMQSGLR
RFEFQQSFFRHGYKTLVLPDAAALGYRKDTLYFFGMDSGGLFAGRAATIPDGSVSIAVCL
PYSGNPSLNTTDEPTMRAFFDRYFAKLPQDARDEMLRQFLAKPSNDLINVRSSTFHYKGN
ALLLGDAAHATAPFLGQGMNMALEDARAFVELLDRHQGDQDKAFPEFTAQRKVQADAMQD
MARANYDVLSCSNPIFFMRARYTRYMHDKFPGLYPPDMAEKLYFTSEPYDRLQQIQSKQN
VWYKIGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaagagagcaatcatagtcggaggcgggctcgcgggcgggctgaccgccatctacctg
gcgaagcgcggctacgaggtgcatgtggctgaaaagcgcggcgatccgctgcaagactta
tcgtcctatgtggacgtggtcagctcgcgggcgataggcgtcagcatgacggtgcgcggc
atcaaggcggtgctggccgccggcatcccgagacaagagctggaggcctgcggcgagccc
atcgtggcgatggcgttctcggtcggcggccagtatcggatgcgggaactgaagccgttg
gaggatttccgccccttgtcgctgaaccgcgcggccttccagaaactgctgaacaagtac
gccaatctggccggcgtccgctattacttcgagcacaaatgcctggaggtggatctggag
ggcaagtcggtgctgatccaagacaaggatggccaatcgctgcgtctggccggcgacatg
atcatcggtgccgacggcgcccactcggcggtgcggcaggcgatgcagagcggcctgcgc
cgcttcgaattccagcagtccttcttccgccacggctacaagacgctggtgttgccggac
gcggcggcgctgggctatcgcaaggacacgctgtacttcttcggcatggattccggcggc
ctgttcgccggccgcgccgccaccatcccggacggcagcgtcagcatcgcggtctgcctg
ccttatagcggcaaccccagcctgaacaccaccgatgagccgacgatgcgcgccttcttc
gaccgttatttcgccaagctgccgcaagacgcgcgcgacgagatgctgcgccaatttctg
gccaagcccagcaacgacctgatcaatgtccgctccagcaccttccattacaagggcaat
gcgctgctgctgggcgacgccgcccacgccaccgcgcccttcctcggccagggcatgaac
atggcgctggaggacgcccgcgcctttgtcgaattgctggaccgccaccagggcgatcag
gacaaggccttccccgagttcaccgcgcagcgcaaggtgcaggcggacgcgatgcaggac
atggcgcgcgccaactacgacgtgctcagttgctccaatcccatctttttcatgcgcgcc
cgctacacccgctacatgcacgacaagtttcccggcctttacccgccggacatggcggag
aagctgtatttcacgtcggaaccttacgacaggctgcagcagatccagagcaagcagaac
gtttggtacaaaatagggagggtcaactga

DBGET integrated database retrieval system