KEGG   Chromobacterium phragmitis IIBBL 112-1: DK842_01230
Entry
DK842_01230       CDS       T05549                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
chri  Chromobacterium phragmitis IIBBL 112-1
Pathway
chri00404  Staurosporine biosynthesis
chri01100  Metabolic pathways
chri01110  Biosynthesis of secondary metabolites
chri02024  Quorum sensing
Module
chri_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:chri00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    DK842_01230
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DK842_01230
Enzymes [BR:chri01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     DK842_01230
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Pyr_redox_2 DAO NAD_binding_8 Pyr_redox GIDA SE FAD_binding_2 HI0933_like FAD_oxidored
Other DBs
NCBI-ProteinID: AXE28658
Position
complement(238515..239804)
AA seq 429 aa
MKRAIIVGGGLAGGLTAIYLAKRGYEVHVAEKRGDPLQDLSSYVDVVSSRAIGVSMTVRG
IKAVLAAGIPRQELEACGEPIVAMAFSVGGQYRMRELKPLEDFRPLSLNRAAFQKLLNKY
ANLAGVRYYFEHKCLEVDLEGKSVLIQDKDGQSLRLAGDMIIGADGAHSAVRQAMQSGLR
RFEFQQSFFRHGYKTLVLPDAAALGYRKDTLYFFGMDSGGLFAGRAATIPDGSVSIAVCL
PYSGSPSLNTTDEPTMRAFFDRYFAKLPQDARDEMLRQFLAKPSNDLINVRSSTFHYKGN
ALLLGDAAHATAPFLGQGMNMALEDARAFVELLDRHQGDQDKAFPEFTAQRKVQADAMQD
MARANYDVLSCSNPIFFMRARYTRYMHDKFPGLYPPDMAEKLYFTSEPYDRLQQIQSKQN
VWYKIGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaagagagcaatcatagtcggaggcgggctcgcgggcgggctgaccgccatctacctg
gcgaagcgcggctacgaggtgcatgtggctgaaaagcgcggcgatccgctgcaagactta
tcgtcctatgtggacgtggtcagctcgcgggcgataggcgtcagcatgacggtgcgcggc
atcaaggcggtgctggccgccggcatcccgagacaagagctggaggcctgcggcgaaccc
atcgtggcgatggcgttctcggtcggcggccagtatcggatgcgggaactgaagccgttg
gaggatttccgccccttgtcgctgaaccgcgcggccttccagaaactgctgaacaagtac
gccaatctggccggcgtccgctattacttcgagcacaaatgcctggaggtggacctggag
ggcaagtcggtgctgatccaggacaaggatggccaatcgctgcgtctggccggcgacatg
atcatcggcgccgacggcgcccactcggcggtgcggcaggcgatgcagagcggcctgcgc
cgcttcgaattccagcagtccttcttccgccacggctacaagacgctggtgttgccggac
gcggcggcgctgggctatcgcaaggacacgctgtacttcttcggcatggattccggcggc
ctgttcgccggccgcgccgccaccatcccggacggcagcgtcagcatcgcggtctgcctg
ccttatagcggcagccccagcctgaacaccaccgacgagccgacgatgcgcgccttcttc
gaccgttatttcgccaagctgccgcaagacgcgcgcgacgagatgctgcgccagttcctg
gccaaacccagcaacgacctgatcaatgtccgctccagcaccttccactacaagggcaat
gcgctgctgctgggcgacgctgcccacgccaccgcgcccttcctcggccagggcatgaac
atggcgctggaggacgcccgcgcctttgtcgaattgctggaccgccaccagggcgatcag
gacaaggctttccccgagttcaccgcgcagcgcaaggtgcaggcggacgcgatgcaggac
atggcgcgagccaactacgacgtgctcagttgctccaatcccatctttttcatgcgcgcc
cgctacacccgctacatgcacgacaagtttcccggcctttacccgccggacatggcggag
aagctgtatttcacgtcggaaccgtacgacaggctgcagcagatccagagcaagcagaac
gtttggtacaaaatagggagggtcaactga

DBGET integrated database retrieval system