KEGG   Chromobacterium paludis: FYK34_10585
Entry
FYK34_10585       CDS       T06224                                 

Name
(GenBank) FAD-dependent monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
chrm  Chromobacterium paludis
Pathway
chrm00404  Staurosporine biosynthesis
chrm01100  Metabolic pathways
chrm01110  Biosynthesis of secondary metabolites
chrm02024  Quorum sensing
Module
chrm_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:chrm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    FYK34_10585
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FYK34_10585
Enzymes [BR:chrm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     FYK34_10585
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Pyr_redox_2 DAO NAD_binding_8 Pyr_redox GIDA FAD_binding_2 SE FAD_oxidored HI0933_like Fumerase_C 3HCDH_N
Other DBs
NCBI-ProteinID: QEL55971
UniProt: A0A5C1DGS7
Position
complement(2285747..2287036)
AA seq 429 aa
MKRAIIVGGGLAGGLTAIYLARRGYEVHVVEKRGDPLQDLSSYVDVVSSRAIGVSMTVRG
IKAVLAAGIPRAELEACGEPIVAMAFSVGGQYRMRELKPLEDFRPLSLNRAAFQKLLNKY
ANLAGVRYYFEHKCLEVDLEGKSVLLQSKDGQSLRLAGDMIIGADGAHSAVRQAMQSGLR
RFEFQQSFFRHGYKTLVLPDAAALGYRKDTLYFFGMDSGGLFAGRAATIPDGSVSIAVCL
PYSGSPSLNTTDEPTMRAFFDRYFAKLSLDARDEMLRQFLAKPSNDLINVRSSTFHYKGN
VLLLGDAAHATAPFLGQGMNMALEDARAFVELLDRHQGDQDKAFPEFTAQRKVQADAMQD
MARANYDVLSCSNPIFFMRARYTRYMHSKFPGLYPPDMAEKLYFTSEPYDRLQQIQRKQN
VWYKIGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaagagagcaatcattgtcggaggcgggctcgccggtgggctgaccgccatttacctg
gcgcggcgcggctacgaggtccacgtggtggagaagcgcggcgatccgctgcaagacctg
tcgtcctatgtggacgtggtcagctcgcgggcgataggcgtcagcatgacggtgcgcggc
atcaaggcggtgctggccgccggcattccgcgcgcggagctggaggcctgcggcgaaccc
atcgtggcgatggcgttttccgtcggcggccagtaccgcatgcgggagctgaagccgttg
gaggatttccgccccttgtcgctgaaccgcgcggcgtttcagaagctgctgaacaagtac
gccaatctggccggcgttcgttattacttcgagcacaaatgcctggaggtggacctggag
ggcaagtcggtgctgctccagagcaaggacggccagtcgctgcggctggccggcgacatg
atcatcggcgccgacggcgcgcactcggcggtgcggcaggcgatgcagagcggcttgcgc
cgcttcgaattccagcagtcctttttccgccatggctacaagacgctggtgttgccggac
gccgcggcgctgggctatcgcaaggacacgctgtactttttcggcatggattccggcggc
ctgttcgccggccgcgccgccaccatcccggacggcagcgtcagcatcgcggtctgcctg
ccttatagcggaagccccagcctgaacaccaccgacgagccgacgatgcgcgccttcttc
gaccgctacttcgccaagctgtcgctggacgcgcgcgacgagatgctgcgccagttcctg
gccaaacccagcaatgacctgatcaacgtccgctccagcaccttccactacaagggcaat
gtgctgctgctgggcgacgccgcccacgccaccgcgcccttcctcggccagggcatgaat
atggcgctggaggacgcgcgcgccttcgtcgaattgctggaccgccatcagggcgaccag
gacaaggccttccccgagttcaccgcgcagcgcaaggtgcaggccgacgcgatgcaggac
atggcgcgcgccaactacgacgtgctcagctgctccaatcccatcttcttcatgcgggcc
cgctacacccgctacatgcatagcaagtttcccggcctttacccgccggacatggcggag
aagctgtacttcacgtcggagccgtacgacagactgcagcagatccagagaaaacagaac
gtttggtacaagatagggagggtcaactga

DBGET integrated database retrieval system