KEGG   Citrus clementina (mandarin orange): CICLE_v10008336mg
Entry
CICLE_v10008336mg CDS       T02982                                 
Name
(RefSeq) hypothetical protein
  KO
K21587  coumarin 8-geranyltransferase [EC:2.5.1.138]
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CICLE_v10008336mg
Enzymes [BR:cic01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.138  coumarin 8-geranyltransferase
     CICLE_v10008336mg
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 18053799
NCBI-ProteinID: XP_006450323
UniProt: V4TSM2
Position
Unknown
AA seq 435 aa
MMLQMHSSSSFSPKYYYPLQHAGCDKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYST
NKIKNNENTSSRNCKPFNKYRVAVTLQQQGCASNNEDDINSTSFWDVLLKKLHALYVFTR
PFAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDK
VNKPDLPLASGDLSMGTGLAITLTLSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLP
FLRWKKKPFLAGMCMVTVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVM
SLLKDIPDEDGDKQFGFQSISSKLGKENVLRLCVYALFFAYGVSVIVGASSSFQLVKLVS
IIGHSTLAFLLWLRAQTVDLSNNASTYSFYMFIWKASVIDLFNLMFEFEIKFTQVRLFSS
RLTSNYFVEFAVVLC
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgatgcttcaaatgcattcgagttcaagcttctctccaaagtactactatcctttgcaa
catgctggttgcgacaaaacacttcaattaccgttgacaaaagtgcatggcggcttgaac
agaagtgaaagcaagaattacgctatcaaatgcacacaaagtgattcgttttattcgacc
aataaaatcaaaaacaatgaaaacacaagcagcagaaattgtaaaccgttcaacaaatac
cgcgttgctgtcacattacaacaacaaggttgtgcatcaaacaatgaggatgatattaac
tcgacgagcttttgggatgttctcctgaagaaattacatgcattatatgtttttactcgt
cccttcgctatgattggcactattgttgggataacatcaattgccattctgccactgcaa
agctttgctgatttgactccaaaatatttcatggaattcttaaaggccctgttgtccgca
gtactgatgaacaattatgtagggactgtaaatcaggtggccgatgttgaaattgacaag
gttaacaagcccgacctcccactagcttccggtgacttatcaatgggaactggactcgca
atcactttaacattgtctttgacgagcctggctatcgcacttagccttcaatctccacca
cttatctttggcctcattgtatggtttctacttggaactgcttattccgtcgaccttccc
tttcttagatggaagaaaaaaccatttctagccggaatgtgcatggttactgtgttcgga
cttgtataccaattttctttcttcatacacttccagaaatatgtgcttggtagaccggtc
gtaattacgagaccattgatatttgcggccgctatcatcagtaccatttctgctgtaatg
tcactcctcaaggatatacccgacgaggatggcgataaacaatttggctttcagtcaata
tcttccaagttagggaaagaaaatgtacttcggctttgtgtttatgcgctgttttttgca
tatggagtttctgtcatagttggagcttcttcgtctttccagttagtcaagcttgtcagt
ataattggccactccacacttgctttcttattgtggcttcgagctcagactgtggatctc
tccaataatgcatctacatattctttttacatgttcatttggaaggcaagtgtgattgat
ctatttaatttaatgtttgaattcgaaatcaaattcacgcaagttcgattatttagttct
agattgacttctaattattttgttgaatttgcagttgttctatgctga

DBGET integrated database retrieval system