KEGG   Citrus clementina (mandarin orange): CICLE_v10015614mg
Entry
CICLE_v10015614mg CDS       T02982                                 
Name
(RefSeq) hypothetical protein
  KO
K21736  Delta12 acyl-lipid conjugase (11E,13E-forming) / acyl-lipid (9+3)-(E)-desaturase [EC:1.14.19.33 1.14.19.34]
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CICLE_v10015614mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.33  Delta12 acyl-lipid conjugase (11E,13E-forming)
     CICLE_v10015614mg
    1.14.19.34  acyl-lipid (9+3)-(E)-desaturase
     CICLE_v10015614mg
SSDB
Motif
Pfam: FA_desaturase DUF3474
Other DBs
NCBI-GeneID: 18053012
NCBI-ProteinID: XP_006445919
UniProt: V4W054
Position
Unknown
AA seq 379 aa
MGAGGPSLQREKKESLIQPAPHTKPPFTLSQIKKAIPPHCFKRSLLRSFSYVVYDLSFSF
LFYYTATNYFHLLPSPFAYLAWPIYWIFQGCVLTGVWVIAHECGHHAFSDYQWVDDTVGL
ILHSALLVPYFSWKYSHRRHHSNTASLERDEVFVPKTKSEVPFYSKYFNNPPGRALTLLV
TLTLGWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYISDAGIFAATYVLYRVAM
AKGLAWLICVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWDWLRGALSTVDRDYGVL
NKVFHNITDTHVAHHLFSTMPHYHAMEATIAMKPILGEYYQFDGMPFYKAAWREAKECLY
VEPDENSPTKGIFWYRNKL
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgggagctggtggcccttcactccagcgggagaagaaggaaagccttatccagcctgca
ccacatacaaagcctccattcacccttagccaaatcaagaaagctatcccaccccactgc
ttcaagcgctccctcctccgatcattctcttacgtcgtttacgacctctccttttccttc
ctcttctactacactgccaccaattacttccacctcctcccttccccatttgcctacctt
gcttggcccatttactggatattccaaggctgtgttcttaccggtgtttgggtcattgct
cacgagtgtggccaccatgcctttagtgactaccaatgggttgacgataccgttggccta
atcctgcactctgcccttttagttccatacttctcatggaagtacagtcatcgccgccac
cattccaacaccgcatcccttgagcgcgatgaagtgtttgtcccaaaaaccaagtccgaa
gtcccattttactccaaatacttcaacaaccccccaggccgagctctcacccttctagtc
acactcactcttggctggcccttatacttagccttgaatgtttccggcaggccctacgac
cgttttgcttgtcactttgatcccaagagccccatctactcagatcgcgagaggctccag
atatacatttctgatgccggaatctttgctgcaacttacgtcctctatcgcgttgccatg
gcaaaaggactggcctggcttatatgcgtgtatggggtaccgctactcattgtgaatggc
tttcttgtactgatcacatacttgcagcacacgcatcctgcactgccgcactacaactca
tccgaatgggactggctgaggggggctctctcgactgtcgatagagattacggcgtgttg
aacaaagtcttccataacattacagatacacatgtagctcaccatctcttctcaaccatg
ccacattaccatgctatggaggcgacaatcgcgatgaagccaatcctcggcgagtattac
cagttcgatgggatgcccttttacaaggcggcgtggcgggaggcgaaagagtgtctttac
gtagaaccggacgagaattctccgaccaaaggcattttctggtacaggaacaaactgtga

DBGET integrated database retrieval system