KEGG   Celeribacter indicus: P73_0352
Entry
P73_0352          CDS       T03575                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
cid  Celeribacter indicus
Pathway
cid00626  Naphthalene degradation
cid01100  Metabolic pathways
cid01120  Microbial metabolism in diverse environments
cid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    P73_0352
Enzymes [BR:cid01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     P73_0352
SSDB
Motif
Pfam: DSBA Thioredoxin_5
Other DBs
NCBI-ProteinID: AJE45067
UniProt: A0A0B5DXW3
Position
359518..360132
AA seq 204 aa
MSRRPLDFYFDFMSPFSYLAFQKLPGLCEKYGLELRSHVVDLPKLKLLAGNTGPANVTIP
LKARYLRMDLARWASRYGVSLISPKSLETGAVNRAYFFALDRGKGPDFLRAAWDGVWNTG
GDPADPALLERLAIACGCKPEELDAWSGSEEAITRLKAATQAAHDAGVFGVPTMVLGDQM
WWGNDRLTFMEDALSKGLLSSDCQ
NT seq 615 nt   +upstreamnt  +downstreamnt
atgagcagacgccccctcgacttctacttcgacttcatgagtcccttctcctatctggcg
ttccagaagcttcctggtctttgcgagaaatacggtctcgagcttcggtcccatgtggtc
gatctgccgaagctcaagctgctggccgggaataccggacccgcgaatgtgaccatcccg
ctcaaggcccgctatctcaggatggatctcgcgcgctgggcaagccgctatggcgtgtcg
ctgatctctccgaaatcgctggagacgggcgcagtcaacagggcgtatttttttgccctc
gacaggggaaagggcccggatttcctgcgtgccgcctgggacggggtctggaacaccggg
ggagatccggcggatcccgcgctgctggagcgtctggccatcgcctgtggctgcaagccc
gaggagctcgacgcctggagcggttcggaggaggccatcacgcgcctgaaggcggcgacc
caggccgcacatgacgctggcgtgttcggtgttccgaccatggtcctcggggatcaaatg
tggtggggcaacgaccgcctcaccttcatggaggacgccctgagcaagggccttctctca
tctgactgtcagtga

DBGET integrated database retrieval system