KEGG   Citrus sinensis (Valencia orange): 102611163
Entry
102611163         CDS       T02983                                 
Name
(RefSeq) delta(12)-fatty-acid desaturase FAD2
  KO
K21736  Delta12 acyl-lipid conjugase (11E,13E-forming) / acyl-lipid (9+3)-(E)-desaturase [EC:1.14.19.33 1.14.19.34]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102611163
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.33  Delta12 acyl-lipid conjugase (11E,13E-forming)
     102611163
    1.14.19.34  acyl-lipid (9+3)-(E)-desaturase
     102611163
SSDB
Motif
Pfam: FA_desaturase DUF3474
Other DBs
NCBI-GeneID: 102611163
NCBI-ProteinID: XP_006492662
UniProt: A0A067EYY2
Position
Unknown
AA seq 379 aa
MGAGGPSLQREKKESLIQPAPHTKPPFTLSQIKKAIPPHCFKRSLLRSFSYVVYDLSFSF
LFYYTATNYFHLLPSPFAYLAWPIYWIFQGCVLTGVWVIAHECGHHAFSDYQWVDDTVGL
ILHSALLVPYFSWKYSHRRHHSNTASLERDEVFVPKTKSEVPFYSKYFNNPPGRALTLLV
TLTLGWPLYLALNVSGRPYDRFACHFDPKSPIYSDRERLQIYISDAGIFAATYVLYRVAM
AKGLAWLICVYGVPLLIVNGFLVLITYLQHTHPALPHYNSSEWDWLRGALSTVDRDYGVL
NKVFHNITDTHVAHHLFSTMPHYHAMEATIAMKPILGEYYQFDGMPFYKAAWREAKECLY
VEPDENSPTKGLFWYRNKL
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgggagctggtggcccttcactccagcgggagaagaaggaaagccttatccagcctgca
ccacatacaaagcctccattcacccttagccaaatcaagaaagctatcccaccccactgc
ttcaagcgctccctcctccgatcattctcttacgtcgtttacgacctctccttttccttc
ctcttctactacactgccaccaattacttccacctcctcccttccccatttgcctacctt
gcttggcccatttactggatattccaaggctgtgttcttaccggtgtttgggtcattgct
cacgagtgtggccaccatgcctttagtgactaccaatgggttgacgataccgttggccta
atcctgcactctgcccttttagttccatacttctcatggaagtacagtcatcgccgccac
cattccaacaccgcatcccttgagcgcgatgaagtgtttgtcccaaaaaccaagtccgaa
gtcccattttactccaaatacttcaacaaccccccaggccgagctctcacccttctagtc
acactcactcttggctggcccttatacttagccttgaatgtttccggcaggccctacgac
cgttttgcttgtcactttgatcccaagagccccatctactcagatcgcgagaggctccag
atatacatttctgatgccggaatctttgctgcaacttacgtcctctatcgcgttgccatg
gcaaaaggactggcctggcttatatgcgtgtatggggtaccgctactcattgtgaatggc
tttcttgtactgatcacatacttgcagcacacgcatcctgcactgccgcactacaactca
tccgaatgggactggctgaggggggctctctcgactgtcgatagagattacggcgtgttg
aacaaagtcttccataacattacagatacacatgtagctcaccatctcttctcaaccatg
ccacattaccatgctatggaggcgacaatcgcgatgaagccaatcctcggcgagtattac
cagttcgatgggatgcccttttacaaggcggcgtggcgggaggcgaaagagtgtctttac
gtagaaccggacgagaattctccgaccaaaggccttttctggtacaggaacaaactgtga

DBGET integrated database retrieval system