KEGG   Citrus sinensis (Valencia orange): 102618825
Entry
102618825         CDS       T02983                                 
Name
(RefSeq) coumarin 8-geranyltransferase 1b, chloroplastic
  KO
K21587  coumarin 8-geranyltransferase [EC:2.5.1.138]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102618825
Enzymes [BR:cit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.138  coumarin 8-geranyltransferase
     102618825
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 102618825
NCBI-ProteinID: XP_006483444
UniProt: A0A067DVF7
Position
7:complement(3378372..3385112)
AA seq 408 aa
MMLQMHSSSSFSPKYYYPLQHAGCDKTLQLPLTKVHGGLNRSESKNYAIKCTQSDSFYST
NKIKNNENTSSRNCKPFNKYRVAVTLQQQGCASNNEDDINSTSFWDVLLKKLHALYVFTR
PFAMIGTIVGITSIAILPLQSFADLTPKYFMEFLKALLSAVLMNNYVGTVNQVADVEIDK
VNKPDLPLASGDLSMGTGLAITLTLSLTSLAIALSLQSPPLIFGLIVWFLLGTAYSVDLP
FLRWKTKPFLAGMCMVTVFGLVYQFSFFIHFQKYVLGRPVVITRPLIFAAAIISTISAVM
SLLKDIPDEDGDKQFGFQSISSKLGKENVLRLCVYALFFAYGVSVIVGASSSFQLVKLVS
IIGHSTLAFLLWLRAQTVDLSNNASTYSFYMFIWKLFYAEYLLIHFLR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgatgcttcaaatgcattcgagttcaagcttctctccaaagtactactatcctttgcaa
catgctggttgcgacaaaacacttcaattaccgttgacaaaagtgcatggcggcttgaac
agaagtgaaagcaagaattacgctatcaaatgcacacaaagtgattcgttttattcgacc
aataaaatcaaaaacaatgaaaacacaagcagcagaaattgtaaaccgttcaacaaatac
cgcgttgctgtcacattacaacaacaaggttgtgcatcaaacaatgaggatgatattaac
tcgacgagcttttgggatgttctcctgaagaaattacatgcattatatgtttttactcgt
cccttcgctatgattggcactattgttgggataacatcaattgccattctgccactgcaa
agctttgctgatttgactccaaaatatttcatggaattcttaaaggccctgttgtccgca
gtactgatgaacaattatgtagggactgtaaatcaggtggccgatgttgaaattgacaag
gttaacaagcccgacctcccactagcttccggtgacttatcaatgggaactggactcgca
atcactttaacattgtctttgacgagcctggctatcgcacttagccttcaatctccacca
cttatctttggcctcattgtatggtttctacttggaactgcttattccgtcgaccttccc
tttcttagatggaagacaaaaccatttctagccggaatgtgcatggttactgtgttcgga
cttgtataccaattttctttcttcatacacttccagaaatatgtgcttggtagaccggtc
gtaattacgagaccattgatatttgcggccgctatcatcagtaccatttctgctgtaatg
tcactcctcaaggatatacccgacgaggatggcgataaacaatttggctttcagtcaata
tcttccaagttagggaaagaaaatgtacttcggctttgtgtttatgcgctgttttttgca
tatggagtttctgtcatagttggagcttcttcgtctttccagttagtcaagcttgtcagt
ataattggccactccacacttgctttcttattgtggcttcgagctcagactgtggatctc
tccaataatgcatctacatattctttttacatgttcatttggaagttgttctatgctgaa
tatctccttattcacttcttacgatga

DBGET integrated database retrieval system