Citrobacter sp. Y3: HAP28_05475 Help Entry HAP28_05475       CDS       T10856                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism ciy  Citrobacter sp. Y3 Brite KEGG Orthology (KO) [BR:ciy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ciy03400]     HAP28_05475 (mutT) Enzymes [BR:ciy01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      HAP28_05475 (mutT) DNA repair and recombination proteins [BR:ciy03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     HAP28_05475 (mutT)  Prokaryotic type     HAP28_05475 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Nudt16-like NUDIX_2 Motif Other DBs NCBI-ProteinID:  QIO38523 Position 1137191..1137583 Genome browser AA seq 130 aa AA seqDB search MKKLNIAVGIIRNPYNEIFITQRAADAHMANKLEFPGGKIEAGETPEQALSRELQEEVGI TPVGATLFEKLEYQFPDRHITLWFWLVESWKGEPWGKEGQPGKWIAAGMLQAEDFPPANA PVIAKLKQNL NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaactgaacatcgcggtcgggattattcgtaatccgtataacgaaatctttatc acccagcgtgcggccgacgcgcatatggcgaataaactggaatttccaggcggaaagatt gaggcgggagagacgccggagcaggcgctgagccgcgagctacaggaagaggtgggcatt acgccggtaggtgccacgcttttcgagaagctggagtatcagtttccggacaggcatatc acgctgtggttctggctggtggaaagctggaaaggtgaaccgtggggaaaagaggggcag cctggaaaatggattgccgccgggatgttgcaggcggaggatttccctccggcgaatgcg cccgtgattgcgaagttaaaacaaaacctgtag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (4) Pfam (4) All databases (5) Download RDF

DBGET integrated database retrieval system