KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404344
Entry
100404344         CDS       T03264                                 

Gene name
CYP3A4, CYP3A21, CYPIIIA21
Definition
(RefSeq) cytochrome P450, family 3, subfamily A, polypeptide 4
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00140  Steroid hormone biosynthesis
cjc00591  Linoleic acid metabolism
cjc00830  Retinol metabolism
cjc00980  Metabolism of xenobiotics by cytochrome P450
cjc00982  Drug metabolism - cytochrome P450
cjc00983  Drug metabolism - other enzymes
cjc01100  Metabolic pathways
cjc04976  Bile secretion
cjc05204  Chemical carcinogenesis - DNA adducts
cjc05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100404344 (CYP3A4)
   00591 Linoleic acid metabolism
    100404344 (CYP3A4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100404344 (CYP3A4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100404344 (CYP3A4)
   00982 Drug metabolism - cytochrome P450
    100404344 (CYP3A4)
   00983 Drug metabolism - other enzymes
    100404344 (CYP3A4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100404344 (CYP3A4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    100404344 (CYP3A4)
   05207 Chemical carcinogenesis - receptor activation
    100404344 (CYP3A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cjc00199]
    100404344 (CYP3A4)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     100404344 (CYP3A4)
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     100404344 (CYP3A4)
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     100404344 (CYP3A4)
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     100404344 (CYP3A4)
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     100404344 (CYP3A4)
    1.14.14.-  
     100404344 (CYP3A4)
Cytochrome P450 [BR:cjc00199]
 Cytochrome P450, animal type
  CYP3 family
   100404344 (CYP3A4)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100404344
NCBI-ProteinID: NP_001191369
Ensembl: ENSCJAG00000035708
UniProt: O18993
Position
2
AA seq 503 aa
MDFIPNLAVETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGTVLYYRQGFWKF
DMECYKKYGKMWGIYDGRQPVLAITDPNIIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AQDDEWKRIRSLLSPTFTSGKLKEMVPIIAQYGEVLVRNLRREAEKGKPINMKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKLLRFDFLDPFFLSITIFPFLTPILEALNISM
FPRDSTSFLRKSIKRIKESRLKDTHKHRVDFLQLMIDSQNSKETESDKALSDLELVAQSI
IFIFAGYETTSSTLSFIMYELATHPDVQQKLQEEIDAVLPNKAPATYDTVLQMEYLDMVV
NETLRLFPLAMRLERVCKKDVEINGVFIPKGVVVMIPSYALHYDPKYWTEPEKFLPERFS
KNNKDNIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKVEPRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatttcatcccaaacttggccgttgaaacctggcttctcctggctgtcagcctggtg
cttctgtatctatatggaactcattcacatgggctttttaagaagcttggaattccagga
cccacacctctgccctttttgggaactgttttgtactaccgtcagggcttttggaagttt
gacatggaatgttacaagaagtatggaaaaatgtgggggatttatgatggtcgacagcct
gtgctggctatcacagatcccaacataatcaaaacagtgctagtgaaagaatgttattct
gtcttcactaaccggaggcctttcggtccggtgggatttatgaaaagtgccatctctata
gctcaggatgatgaatggaagagaatacgatcattgctatctccaaccttcaccagtgga
aaactcaaagagatggtccctatcattgcccagtatggagaggtgttggtgagaaacctg
aggcgggaagcagagaaaggcaagcccatcaacatgaaagacatctttggggcctacagc
atggatgtgatcactggcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaagcaccaagaagcttttaagatttgactttttagatccattcttt
ctctcaataacaatctttccattccttaccccaattcttgaagcattaaatatttccatg
tttccaagagattctacaagttttttaagaaaatctataaaaaggataaaagaaagtcgc
ctcaaagatacacataagcaccgagtggatttccttcagctgatgattgactcccagaat
tcgaaagaaactgagtctgacaaagctctgtctgatctggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagcactctttccttcattatgtatgag
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aacaaggcaccagccacctatgacactgtgctacagatggagtatcttgacatggtggtg
aatgaaacactcagattattcccacttgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatggggtgttcattcccaaaggggtagtggtgatgattccaagctatgct
cttcactatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aagaataacaaggacaacatagatccttacatatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaaggttgagccaagggatgggactgta
agtggagcctga

DBGET integrated database retrieval system