KEGG   Clostridium sporogenes: CLSPO_c34040
Entry
CLSPO_c34040      CDS       T03905                                 

Symbol
fldH
Name
(GenBank) phenyllactate dehydrogenase FldH
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cld  Clostridium sporogenes
Pathway
cld00350  Tyrosine metabolism
cld00360  Phenylalanine metabolism
cld00380  Tryptophan metabolism
cld01100  Metabolic pathways
cld01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLSPO_c34040 (fldH)
   00360 Phenylalanine metabolism
    CLSPO_c34040 (fldH)
   00380 Tryptophan metabolism
    CLSPO_c34040 (fldH)
Enzymes [BR:cld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     CLSPO_c34040 (fldH)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Other DBs
NCBI-ProteinID: AKC64095
UniProt: A0A7U4JRP7
Position
complement(3701737..3702732)
AA seq 331 aa
MKILAYCVRPDEIDSFKNFSEKYGHTVDLIPDSFGPSVAHLAKGYDGISILGNDTCNREA
LEKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTVGLALSLTRKI
PFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYDIFENE
KAKEYIEYKSLDEVYKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARGALIDS
EALIEGLKSGKIAGAALDSYEYEQGVFHNNKMNEIMKDDTLARLKSFPNVVITPHLGFYT
DEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaattttagcttattgtgtaagacctgatgaaattgattcatttaaaaatttttct
gaaaaatatggacatactgttgatttaataccagattcttttggtccaagtgtggctcat
ttagctaaaggatatgatggcatttcaattttgggaaatgatacttgtaacagagaagca
ttagagaaaattaaagattgtggtataaaatatttagcaaccagaactgctggagtaaat
aatatagattttgatgctgcaaaagaatttggtataaatgtagctaatgttccagcttat
tctcctaattcagtttcagagtttactgtaggactcgcattatccctaacaaggaaaatt
ccttttgcattaaaaagagtagagcttaacaattttgcattaggtggattaataggagta
gaattaagaaacttaactttaggagttataggaactggaagaataggtttaaaagtaatt
gaaggcttttcaggctttggtatgaaaaagatgataggttacgatatttttgaaaatgaa
aaggctaaagaatatattgaatataaatctttagatgaagtatataaagaagcagacata
ataacactacatgcacctttaacagatgataattaccatatgatagggaaagagagtatt
gctaaaatgaaagacggtgtattcataataaatgcagcacgaggagcattaattgatagt
gaagctttaatagaaggactgaaatctggtaaaatagctggagcagccttagattcttat
gaatatgaacaaggagttttccataacaataaaatgaatgaaatcatgaaagatgataca
ttagcaagacttaagagttttccaaatgtagttattacacctcatttaggattctataca
gatgaagctgtatcaaatatggttgaaattactcttatgaatttacaagagtttgaatta
aaaggaacttgtaaaaatcaaagagtatgtaaataa

DBGET integrated database retrieval system