KEGG   Chlorobaculum limnaeum: BIU88_11010
Entry
BIU88_11010       CDS       T04492                                 

Definition
(GenBank) hypothetical protein
  KO
K21312  bacteriochlorophyllide c C-7(1)-hydroxylase [EC:1.17.98.2]
Organism
clz  Chlorobaculum limnaeum
Pathway
clz00860  Porphyrin and chlorophyll metabolism
clz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BIU88_11010
Enzymes [BR:clz01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.98  With other, known, physiological acceptors
    1.17.98.2  bacteriochlorophyllide c C-71-hydroxylase
     BIU88_11010
SSDB
Motif
Pfam: Radical_SAM
Other DBs
NCBI-ProteinID: AOS84617
UniProt: N0DKX5
Position
complement(2441120..2442328)
AA seq 402 aa
MSTKRVITKEDIHLKARLLSEGAKVTVNKPPASGFNPFRAMVLNGSDLATLVRQEPYTRL
EVQVNGDDVEFYDCGQHLASGRMQEAFSWRSGKLSNGRPVDAAVIGMNQDIINIHYSYSC
DNNNTGRSCRFCFFFADQHIGVGKELAKMPFSKIEELAKEQAEAVKIATDAGWRGTLVII
GGLVDPSRRAQVADLVELVMAPLREQVSPEVLNELHITANLYPPDDFKEMEKWKASGLNS
TEFDLEVTHPDYFKAICPGKSATYPLEYWLEAQEASVKIFGPGRGTTSFILMGLEPMNIM
LEGVEERMSKGVYPNMLVYQPVPGADMFRMPPPNADWLVEASEKVADLYIKYQDRFDMPL
AKDHRPGYTRMGRSQYIILAGDMLAYKLQEQGYELPEAYPVC
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgagcacaaaaagggttattaccaaagaagatattcatttaaaggcgcgactgctttcc
gagggcgccaaggtgacggttaacaaaccaccagcctccggctttaatcccttcagggcg
atggtgcttaacggcagtgaccttgcaacgcttgtaaggcaggagccttatacccgtctt
gaggtccaggtcaatggcgacgatgtcgagttttacgattgcggccagcacctggcaagc
gggcggatgcaggaggctttttcctggcgtagcggcaagctcagtaacggtcgcccggtc
gatgcagccgtcatcggcatgaatcaggatatcatcaatatccattacagttacagctgt
gacaacaacaacaccgggcgttcctgccgcttctgctttttctttgcagatcagcatatc
ggtgtaggcaaggaactggcaaaaatgccgttttccaagatcgaagaactggctaaagag
caggctgaagctgttaaaatcgccactgatgcgggttggagaggtactcttgtcattatc
ggtggacttgtcgatccttcgaggcgagcccaggttgccgatctggtggagctggttatg
gctcctttgcgtgagcaggtcagtcctgaagtactgaacgaactccatataacagccaac
ctttacccgccggacgatttcaaggaaatggagaagtggaaagcttccggcctcaactcc
accgagtttgatctcgaggtgacacatccagattacttcaaggcgatctgtcctggaaaa
tccgcgacctatcctcttgagtactggctcgaagcccaggaggcctcggtcaaaattttc
ggcccaggcaggggaacgacgagcttcatcctgatggggctcgaaccgatgaacatcatg
ctcgaaggtgtcgaggagcgaatgtcgaagggagtctatcccaatatgcttgtctatcag
ccggtaccgggtgccgatatgttcagaatgcctcctccgaacgccgactggctggtcgag
gcctccgaaaaggttgccgatctctatatcaagtaccaggatcgtttcgacatgcctctt
gccaaggatcatcgtcccggttacacgagaatggggcgttcccagtatattattctcgcc
ggagatatgctggcctacaagcttcaggagcagggttacgaattgcccgaagcctacccc
gtctgttag

DBGET integrated database retrieval system