KEGG   Cupriavidus necator N-1: CNE_BB1p03440
Entry
CNE_BB1p03440     CDS       T01564                                 

Symbol
tcpA
Name
(GenBank) 2,4,6-trichlorophenol monooxygenase TcpA
  KO
K24293  3,5,6-trichloropyridin-2-ol/2,4,6-trichlorophenol monooxygenase [EC:1.14.14.172 1.14.14.173]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00361  Chlorocyclohexane and chlorobenzene degradation
cnc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    CNE_BB1p03440 (tcpA)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.172  3,5,6-trichloropyridin-2-ol monooxygenase
     CNE_BB1p03440 (tcpA)
    1.14.14.173  2,4,6-trichlorophenol monooxygenase
     CNE_BB1p03440 (tcpA)
SSDB
Motif
Pfam: HpaB_N HpaB
Other DBs
NCBI-ProteinID: AEI81768
UniProt: F8GWP8
Position
BB1p:345625..347178
AA seq 517 aa
MIRTGKQYLESLNDGRNVWVGNEKIDNVATHPKTRDYAQRHADFYDLHHRPDLQDVMTFV
DKDGERRTMQWFGHFDKEQLRRKRKYHETIMREMAGASFPRTPDVNNYVLQTYIDDPSPW
ETQTIGAEGKVKAKNIVDFVNFAKKHDLNCAPQFVDPQMDRSNPDAQQRSPGLRVIEKND
KGIIVSGVKAIGTGVAFADWIHIGVFFRPGIPGDQIIFAATPVNTPGVTIVCRESVVKED
PIEHPLASQGDELDGMTVFDNVFIPWSHVFHLGNPEHAKLYPQRVFDWLHYHALIRQSVR
AELMAGLAILITEHIGTNKIPAVQTRVAKLIGFHQAMLAHIVASEELGFHTPGGAYKPNI
LIYDFGRALYLENFSQMIYELVDLSGRSALIFASEDQWNDEALNGWFERMNNGPVGQPHD
RVKIGRVIRDLFLTDWGNRLFVFENFNGTPLQAIRMLTMQRAEFSAAGPYGTLARKVCGI
ELSEGHESEYKATAGYAQALDSARHQEKLALSGTMTV
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgattcgcactggcaagcagtacctggaatcgctcaacgacggccgcaacgtatgggtc
ggcaacgagaagatcgacaacgtcgcgacgcaccccaagacgcgggactacgcgcagcgg
cacgccgacttctacgacctgcaccatcgtcccgacctgcaggacgtgatgaccttcgtc
gacaaggatggcgagcgccgcaccatgcagtggttcggccacttcgacaaggaacagctg
cgccgcaagcgcaagtaccacgagacgatcatgcgcgagatggccggcgcgtcgttcccg
cgcacgccggacgtcaacaactacgtgctgcagacctatatcgacgatccgtcgccgtgg
gaaacgcagaccatcggcgctgaaggcaaggtcaaggcgaagaacatcgtcgacttcgtc
aacttcgccaagaagcacgacctgaactgcgcgccgcagttcgtcgatccgcagatggat
cgctccaaccccgatgcccagcagcgttcgccggggctgcgcgtgatcgagaagaacgac
aagggcatcatcgtgtcaggggtcaaggccatcggcaccggcgtcgcctttgccgactgg
atccatatcggggtgttcttccgccccggcatcccgggcgaccagatcatcttcgctgcc
acgccggtcaacaccccgggcgtgaccatcgtctgccgtgagagcgtggtcaaggaggat
cccatcgaacacccgttggcctcgcagggcgatgagctggacggcatgacggtattcgac
aacgtcttcatcccatggtcgcacgtgttccacctgggcaaccccgagcacgcgaagctc
tacccgcagcgcgtgttcgactggctgcactatcacgcgctgatccgccagtccgtgcgc
gccgagctgatggctggcctggcgatcctgatcaccgagcatatcggcaccaacaagatc
cccgcggtgcagacgcgcgtggcaaagctgatcgggttccaccaggccatgctcgcgcac
atcgtcgcgagcgaagagctgggcttccatacgccggggggtgcctacaagccgaacatc
ctgatctacgacttcggccgggcgctgtacctcgagaacttctcgcagatgatctacgag
ctggtcgatctctccgggcgcagcgcgctgatcttcgcgagtgaggaccagtggaacgac
gaggcgctcaacggctggttcgaacgcatgaacaacggtcccgtgggtcagccacacgac
cgcgtgaagatcggccgcgtgatccgcgacctgttcctgaccgactggggcaaccgcctg
ttcgtcttcgagaacttcaacggcaccccgctgcaggccatccgcatgctgaccatgcag
cgtgccgagttctccgctgccgggccatacggcaccctggcgcgcaaggtctgcggcatc
gaactcagcgaaggccacgagagcgaatacaaggccaccgccggctacgcccaggctttg
gattcggcgcggcaccaggaaaagcttgccctgagcggcacgatgactgtgtga

DBGET integrated database retrieval system