KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_19105
Entry
TQ29_19105        CDS       T04096                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00626  Naphthalene degradation
con01100  Metabolic pathways
con01120  Microbial metabolism in diverse environments
con01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    TQ29_19105
Enzymes [BR:con01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     TQ29_19105
SSDB
Motif
Pfam: DSBA Thioredoxin_5 Thioredoxin_4
Other DBs
NCBI-ProteinID: ALG92379
UniProt: A0A0N9NVJ9
Position
pNS6002:complement(98934..99494)
AA seq 186 aa
MSPFAYLAFHKVPGICKQYGLEFRPHVVNLPQLKLMAGNTAPPNVSLPLKIRYLSKDLNR
WAEEYGLPLTFPKSLASEKLNKAFLYAMAKGEGEAFIRTAWDRVWGEGADLADPALLDEL
AKQFGWNPDVLSAWVSSKDATDQYEASTQAAHEAGVFGTPTMIVGDQMWWGNDRITFMER
TLQQEL
NT seq 561 nt   +upstreamnt  +downstreamnt
atgagccccttcgcttatctggcctttcacaaggtgccggggatctgcaagcaatacggt
ctggagtttcggccccatgtcgtgaacctgccgcaactcaaactcatggcggggaatacc
gcaccaccaaatgtcagcctgccgttgaagattcgctatttgagcaaggatctcaaccgt
tgggctgaggaatatggtttgcctttgacctttccgaagtcactcgcgtccgagaagctc
aacaaggcttttctttatgcaatggcgaaaggcgagggagaagccttcatccggactgcg
tgggaccgggtctggggagagggtgcagacttggctgacccggcgttgctggatgaattg
gcgaagcagttcggctggaatcccgatgttctgtcggcttgggtttcatcgaaggatgct
acagaccaatacgaggcgagcacgcaggccgcgcatgaggcaggtgtgtttggtacgccc
acgatgattgtgggtgatcagatgtggtgggggaatgaccgcatcacatttatggaaaga
acgctccagcaggagctttga

DBGET integrated database retrieval system