KEGG   Candida orthopsilosis: CORT_0G03830
Entry
CORT_0G03830      CDS       T02488                                 
Name
(RefSeq) aldose reductase
  KO
K19654  2-dehydropantolactone reductase [EC:1.1.1.358]
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CORT_0G03830
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.358  2-dehydropantolactone reductase
     CORT_0G03830
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 14542245
NCBI-ProteinID: XP_003871185
UniProt: H8XA83
Position
7:complement(789752..790675)
AA seq 307 aa
MTQSNLLSKRFHTKSGKEVSIALGTGTKWKQQQTINEISPELVDNILLALKLGFRHIDTA
EAYNTQKEVGEALKRTDVPREDLWITTKYSPGWGSIKAYSKSPKESIDKALNQLGVDYID
LFLIHSPFFTTEQTHGYTLEQVWEALVEAKKEGKVREIGISNAAISHLERLFAASPSPEY
YPVANQIEFHPFLQNQSKNIVQFSQDHGILVEAFSPLAPLARVESNALAGTLKTLSEKYN
KTEAQILLRYTLQRGILPVTTSSKENRLKESLDLFDFELTKEEVEEINKIGEANPYRAFF
HEAFKDL
NT seq 924 nt   +upstreamnt  +downstreamnt
atgactcaatcaaacttactatcaaaaaggtttcataccaagtctggaaaagaggtttca
attgcacttggtactggcacaaaatggaaacaacaacaaacaatcaatgagatcagccca
gagttagtagacaacattcttttagcgttaaaattgggattcagacacattgacaccgcc
gaagcttacaatacccaaaaggaagtaggggaagcgctcaagagaactgatgttccaaga
gaagacctttggatcactaccaagtatagtccaggttggggttccatcaaagcttacagc
aagtcaccaaaagagtcgattgacaaagctttgaaccaactcggtgttgactacattgac
ttgtttttgatccactctcccttttttacgactgaacaaacccatggttacactttggaa
caggtgtgggaagctctagttgaagcaaagaaagagggcaaagttagagaaatcgggatt
tcaaatgcagctatttctcacttagaaagactatttgcagcttctcctagtcctgagtac
tatcctgttgccaatcaaattgaatttcatccattcttacaaaatcaatcaaaaaacata
gttcaattcagtcaagatcatggtatcttagttgaggcgttttcaccattggcaccctta
gcaagagttgaatcaaatgctcttgctgggactttaaagactttgtctgaaaagtacaac
aagactgaggctcagatattgttgagatacactttacaaagaggaattttgccagtcact
acatcttcgaaggaaaatagattgaaagagtctttagatttgtttgactttgaattgact
aaggaggaagtggaagagatcaacaagattggtgaagccaatccgtatagagcattcttt
cacgaagcattcaaggatttgtag

DBGET integrated database retrieval system