KEGG   Cupriavidus oxalaticus: E0W60_29395
Entry
E0W60_29395       CDS       T06004                                 

Symbol
tcpA
Name
(GenBank) 3,5,6-trichloro-2-pyridinol monooxygenase TcpA
  KO
K24293  3,5,6-trichloropyridin-2-ol/2,4,6-trichlorophenol monooxygenase [EC:1.14.14.172 1.14.14.173]
Organism
cox  Cupriavidus oxalaticus
Pathway
cox00361  Chlorocyclohexane and chlorobenzene degradation
cox01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cox00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    E0W60_29395 (tcpA)
Enzymes [BR:cox01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.172  3,5,6-trichloropyridin-2-ol monooxygenase
     E0W60_29395 (tcpA)
    1.14.14.173  2,4,6-trichlorophenol monooxygenase
     E0W60_29395 (tcpA)
SSDB
Motif
Pfam: HpaB_N HpaB
Other DBs
NCBI-ProteinID: QBY55224
UniProt: A0A4P7LGA7
Position
unnamed1:complement(286279..287832)
AA seq 517 aa
MIRTGKQYLESLNDGRNVWVGNEKIDNVATHPKTRDYAQRHADFYDLHHRPDLQDVMTFV
DTDGERRTMQWFGHFDKEQLRRKRKYHETIMREMAGASFPRTPDVNNYVLQTYIDDPSPW
ETQTIGAEGKIKAKNIVDFVNFAKQHDLNCAPQFVDPQMDRSNPDAQQRSPGLRVIEKND
KGIVVSGVKAIGTGVAFADWIHIGVFFRPGIPGDQIIFAATPVNTPGVTIVCRESVVKDD
PIEHPLASQGDELDGMTVFENVFIPWSHVFHLGNPEHAKLYPQRVFDWLHYHALIRQSVR
AELMAGLAILITEHIGTNKIPAVQTRVAKLIGFHQAMLAHIVASEELGFHTPGGAYKPNI
LIYDFGRALYLENFSEMIYELVDLSGRSALIFASEDQWNDKTLNGWFERMNNGPVGKPHD
RVKIGRVIRDLFLTDWGNRLFVFENFNGTPLQAIRMLTMQRAEFSAAGPYGTLARKVCGI
ELTEVHESEYKATAGYAQALDSARHQEKLALSGTMTV
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgattcgcactggcaagcagtacctggaatcgctcaacgacggccgcaacgtatgggta
ggcaacgagaagatcgacaacgtcgcgacgcaccccaagacacgggactacgcgcagcgc
cacgccgatttctacgacctgcaccatcgccccgacctgcaggatgtgatgaccttcgtc
gacaccgacggcgaacgccgcaccatgcaatggttcggccacttcgacaaggagcagctg
cgccgcaagcgtaagtaccacgagaccatcatgcgcgagatggccggcgcttcgttcccg
cgcacaccggacgtcaacaactacgtgctccagacctacatcgacgatccgtcgccgtgg
gaaacgcagactatcggcgctgagggcaagatcaaggcaaagaacatcgtcgacttcgtc
aacttcgccaagcagcatgacctgaactgtgcgccgcagttcgtcgacccgcagatggac
cgctcgaaccccgatgcccagcagcgctcgcccgggctgcgcgtgatcgagaagaacgac
aagggcatcgtcgtgtcaggtgtcaaggcgatcggcaccggcgtcgcctttgccgactgg
atccacatcggggtgtttttccgccccggcatcccgggcgaccagatcatttttgccgcc
accccggtcaacaccccgggcgtgaccatcgtctgccgcgagagcgtggtcaaggacgat
cccatcgagcatccgctcgcctcacagggcgacgaactggacggcatgactgtattcgag
aatgtcttcatcccctggtcgcacgtgttccacctaggcaaccccgaacacgccaagctc
tacccgcagcgagtgttcgactggctgcactatcacgccctcatccgccagtcggtgcgc
gccgaactgatggccggcctggcgatcctgatcaccgagcatatcggcaccaacaagatt
cccgcagtgcagactcgcgtggccaagctgatcggctttcaccaggccatgctggcgcac
atcgtcgccagcgaggaactgggcttccatacgcctgggggcgcctataagccgaacatc
ctcatctacgacttcggccgcgcgctatacctcgagaacttctcggagatgatctacgag
ctggtcgacctctccgggcgcagcgcactgatctttgccagcgaggaccagtggaacgac
aagaccctgaatggttggttcgagcgcatgaacaacggcccggtcggcaagccgcacgac
cgcgtgaagatcggtcgcgtgatccgcgacctgttcctgaccgactggggcaaccggctg
ttcgtcttcgagaacttcaatggcaccccgctgcaggccatccgcatgctgaccatgcag
cgcgccgagttctccgcagccggtccgtacggcaccctggcccgcaaggtctgcggcatc
gagctcaccgaggtccacgagagcgaatacaaggccaccgccggctacgcccaggcactg
gattcggcgcgacaccaggaaaagctcgcgctgagcggcacgatgaccgtatga

DBGET integrated database retrieval system