KEGG   Carica papaya (papaya): 110825385
Entry
110825385         CDS       T05151                                 
Name
(RefSeq) papain-like
  KO
K06000  papain [EC:3.4.22.2]
Organism
cpap  Carica papaya (papaya)
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cpap01002]
    110825385
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cpap03110]
    110825385
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.2  papain
     110825385
Peptidases and inhibitors [BR:cpap01002]
 Cysteine peptidases
  Family C1: papain family
   110825385
Chaperones and folding catalysts [BR:cpap03110]
 Intramolecular chaperones
  Papain family
   110825385
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29
Other DBs
NCBI-GeneID: 110825385
NCBI-ProteinID: XP_021911524
Position
Unknown
AA seq 345 aa
MAMICLISKLLFVAICLFVHMNLSSGDFSIVNYSQDNLISTERFIQLFESWMLKYNKIYK
NIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADLSNNEFKEKYIGSIAPNYTAAE
LSYDEVLNEGAVNIPEYVDWRQKGAVTPVKQQGSCGSCWTFSAVATIEGIIKIRTGYLNE
YSEQELLDCDRGSYGCRGGFPSSALQLVTRYGIHYRNVYPYEGVQRYCRSSQKGPIAAKI
DGVRQVPQYNEGALIQAIAYQPVSVVLESAGRAFQLYRGGIFEGPCGNRVDHAVTAVGYG
PNYILIKNSWGTGWGEKGFIRIRRGTRNPYGVCGLYSNSCYPVKY
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggctatgatatgtttaatttcaaagttgcttttcgttgcaatatgtctttttgttcat
atgaacttgtcatctggtgatttttctattgtgaattattctcaagataacttaatatct
actgagagatttattcaactttttgaatcatggatgttgaaatacaataaaatttacaag
aatattgatgagaaaatttacagatttgaaatttttaaagacaatcttaaatatattgat
gagacaaacaaaaaaaataacagttactggcttggattaaacgtatttgctgatttaagc
aacaatgaatttaaagaaaagtatattggttctattgctccaaattatacagcagctgaa
ctgtcttatgatgaagtgcttaatgaaggtgctgtaaatattcccgaatatgttgattgg
agacaaaaaggagctgtcactcctgtaaaacaacagggatcttgtggtagttgctggaca
ttttcagctgttgcaactatagagggaataattaaaattagaacagggtatttgaatgaa
tactcagagcaagaactgcttgactgcgatagaggtagctacggatgtagaggaggtttc
ccttcgagtgcacttcaattagtaactcgatatggtattcactatagaaatgtttaccca
tacgagggagtgcaacgttattgtcgctcaagtcagaaaggtccgattgcagcaaaaatc
gatggggttagacaagtgccacaatataacgaaggggctctcatacaagcaattgcatac
caacctgtgagcgtcgtccttgaatcagctggaagagctttccaattgtatagaggggga
atatttgaggggccatgcggaaacagagtagatcatgcagtaacagcagttgggtatgga
ccaaattacatactcataaagaactcatggggtacaggatggggtgagaaaggatttata
agaatcagaagaggcactagaaacccctatggagtatgtggactttattcaaactcatgc
tatcctgttaaatattga

DBGET integrated database retrieval system