KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0270
Entry
Cphamn1_0270      CDS       T00709                                 

Definition
(GenBank) hypothetical protein
  KO
K21312  bacteriochlorophyllide c C-7(1)-hydroxylase [EC:1.17.98.2]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00860  Porphyrin and chlorophyll metabolism
cpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cphamn1_0270
Enzymes [BR:cpb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.98  With other, known, physiological acceptors
    1.17.98.2  bacteriochlorophyllide c C-71-hydroxylase
     Cphamn1_0270
SSDB
Motif
Pfam: Radical_SAM
Other DBs
NCBI-ProteinID: ACE03239
UniProt: B3EL12
Position
261683..262900
AA seq 405 aa
MTTATATKRVISKEDIHLKARLLSEGAKVTVNKPPATGYNPFRAMVINGSDLATLVRQEP
YTRLEVQVNGDDLEFLDCGKHLANGRMQEWFSWRDGTLSNGRPVNAAVIGMNQDIINIHY
SYSCDNNNTGRSCRFCFFFADQHVGVGKELAKMPFSKIEALAKEQAEAVKIATDAGWRGT
LVIIGGLVDPERRGKESELVELVMAPLREQVSPEVLNELHITANLYPPDDFKEMERWKAS
GLNSTEFDLEVTNADYFKAICPGKCATYPLEYWLEAQEASVEIFGPGRGTTSFILMGIEP
MNLMLEGVEERMSKGVYPNMLVYQPVPGADMFRMPPPNADWLVEASEKIADLYFKYEDRF
DMPLAEDHRPGYTRMGRSQYIILAGDEVARRLQEQGHELPEAYPV
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgactacagccacagcgacaaaaagggtaatcagcaaggaggacatacatttaaaggcg
cgtttgctttccgaaggagcgaaggtgaccgtaaacaagccgccggcaacgggctacaat
ccgttccgggctatggtgatcaacggcagcgatcttgccacgcttgtacgccaggaaccc
tatacccgtctcgaggtacaggtcaatggtgatgacctcgaattccttgactgcggaaaa
catctcgcgaacggcagaatgcaggaatggttctcttggcgagacggcacactgagcaat
ggtcgtcctgtcaatgccgcagttatcggtatgaaccaggatataatcaatatccattac
agctacagctgcgacaacaataataccggcaggtcatgccggttctgttttttctttgct
gatcagcatgtaggagttggaaaagagcttgccaagatgccgttctctaaaatcgaggct
cttgcaaaagagcaggccgaagcggttaaaatcgctacagatgcaggttggaggggtact
ctggttattatcggcggcctggtcgatcctgagagacggggtaaggagtctgaacttgtt
gagcttgtaatggctcccctgcgagagcaggtcagccctgaggttctcaatgaacttcat
attacggctaatctttatccgccggatgacttcaaggaaatggagcgctggaaagcctca
ggtctcaactctaccgagttcgatcttgaagtgaccaatgcggactactttaaagcgatc
tgtccaggcaaatgcgcgacctatcctctcgaatactggctagaagctcaggaggcatct
gtagagatcttcggcccgggaaggggaacaacaagttttatcctgatgggtattgaaccg
atgaatttgatgcttgagggcgtagaagaaagaatgtcgaaaggagtctatccgaacatg
cttgtttaccagccggtaccaggtgcggatatgttcaggatgccccctcctaatgcagat
tggcttgttgaggcgtcggaaaaaattgcggatctgtacttcaagtatgaggatcgcttt
gatatgcctcttgctgaagatcatcgcccgggttatacaagaatgggacgttcgcagtac
attatccttgccggagatgaagttgcccgaaggcttcaggagcagggacatgaacttccg
gaagcctatcccgtttga

DBGET integrated database retrieval system