KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0196
Entry
Cpha266_0196      CDS       T00439                                 

Definition
(GenBank) hypothetical protein
  KO
K21312  bacteriochlorophyllide c C-7(1)-hydroxylase [EC:1.17.98.2]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00860  Porphyrin and chlorophyll metabolism
cph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cph00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpha266_0196
Enzymes [BR:cph01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.98  With other, known, physiological acceptors
    1.17.98.2  bacteriochlorophyllide c C-71-hydroxylase
     Cpha266_0196
SSDB
Motif
Pfam: Radical_SAM
Other DBs
NCBI-ProteinID: ABL64263
UniProt: A1BCY6
Position
complement(221628..222833)
AA seq 401 aa
MSTKRIITKEDVHLKARLLSEGAKVTVNKPPKTGFNPFRAMVLNGSDLATLVRPEPYTRL
EVQVNGDDVEFYDCGKHLASGRMQEWFSWRDGTLSNGRPVNAAVIGMNQDIINIHYSYSC
DNNNTGRSCRFCFFFADQHVSVGQDLAKMPFQKIEALAKEQAEAVKIATDNGWRGTLVVI
GGLVAPERRSQVVDLVEIVMAPLREQLSPEVFNELHITANLYPPDDFKDMERWKASGINS
TEFDLEVTDPDYFKAICPGKCATYPLEYWHAAQDASVEIFGPGRGTTSFILMGLEPMNCM
LEGVEERLSKGVYPNMLVYQPVPGADMFRMPPPNADWLVEASEKLADLYFKYQDRFDMPL
ATDHRPGYTRMGRSQYIMLTADVIARRLYEQGYELPAAYPV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgagtactaaaagaattattacgaaggaagatgtgcatttaaaagcaagactgctttcc
gaaggagcaaaggtaacggtcaacaagccgccgaagacaggtttcaatccgtttcgcgcc
atggtgctcaatggaagtgatcttgcaactcttgttcgcccggaaccgtatacccgcctt
gaggtacaggttaacggggacgatgtcgaattttatgattgcggcaaacaccttgcaagc
ggcagaatgcaggagtggttctcatggcgcgacggtacgttgagtaacggacgcccggtt
aatgctgccgtaataggaatgaaccaggatattatcaatattcattacagttacagttgc
gataacaacaatacaggtcggtcatgcagattctgctttttctttgccgaccagcatgta
tctgtagggcaggacctggcaaagatgccgttccagaaaatcgaggctcttgcaaaagag
caggcagaagcggttaaaatagcaaccgataacgggtggagggggactcttgttgttatc
ggaggtcttgttgcgccggaacgtcgttcgcaggttgtcgaccttgttgagattgtcatg
gcgcccttgcgtgaacagttgagtccggaagtgtttaatgaactgcatataacggctaat
ttgtatccgccggatgattttaaggatatggagcgctggaaggcttccggtatcaattca
acagagtttgatctcgaggttaccgatccagactatttcaaggcgatctgcccggggaaa
tgtgcaacatatccccttgaatactggcatgccgcccaggatgcctcagttgagattttc
gggccaggaagggggaccacaagctttatactcatgggtcttgaacctatgaattgtatg
ctggagggtgttgaagagcgcctgtcgaagggggtatatcccaatatgctggtttaccag
cctgtgccgggagctgatatgttcagaatgcctccgccaaacgccgattggctcgttgag
gcttcagagaaactggcagacctgtatttcaagtatcaggatcgttttgatatgcccctt
gctacggaccacaggcccggttatacgcgaatgggacgttcccagtatattatgctgaca
gctgatgtaattgcacgcagattgtatgaacagggttatgaacttcctgcagcatatccg
gtttaa

DBGET integrated database retrieval system