KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000126
Entry
CpipJ_CPIJ000126  CDS       T01079                                 
Name
(GenBank) replication factor C 38kD subunit
  KO
K10756  replication factor C subunit 3/5
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ000126
   03420 Nucleotide excision repair
    CpipJ_CPIJ000126
   03430 Mismatch repair
    CpipJ_CPIJ000126
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ000126
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ000126
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ000126
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    CpipJ_CPIJ000126
  DNA Replication Termination Factors
   ELG1-RFC complex
    CpipJ_CPIJ000126
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    CpipJ_CPIJ000126
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     CpipJ_CPIJ000126
  Check point factors
   HRAD17(Rad24)-RFC complex
    CpipJ_CPIJ000126
SSDB
Other DBs
NCBI-ProteinID: EDS25749
VectorBase: CPIJ000126
UniProt: B0VZ24
AA seq 186 aa
MKFTTPWSNHHIEVNPDGGFYDRIVITEQIAQTQQIDPSGQREIKTIVLSEVKKLTKDAQ
SQRKKKLLRKCAGTFCCWRRARCCSIRSPCNKTCWRSTDRCSWARPLEASWELLSQGFPS
DVTFHGLVENLFKNCDMRLKKQTLYFISLYEHLMQQGSKHIIHRETSVAQVMTQEVFEPC
VRNGHG
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaagtttaccacgccgtggagcaaccatcacatcgaggtaaacccggacggtgggttc
tacgaccggatcgtcatcactgagcagattgcacaaacgcagcaaattgaccccagcggc
cagcgggagattaagacgatcgtgctgtcggaagtgaaaaagctaacgaaggacgcccaa
tcccaaagaaaaaaaaaattgctaagaaagtgcgccggaacattttgttgctggaggcgt
gcaaggtgctgcagtatccgttcaccgtgcaataaaacgtgctggagatcgactgacagg
tgttcctgggcgagaccgctggaagcgagctgggagctgctgtcgcagggttttccatca
gatgtgaccttccacgggttggtggagaatctgttcaagaactgcgacatgcgcctgaag
aagcaaacgctctactttatcagtctgtacgagcacctgatgcagcagggcagtaagcac
atcatccaccgggagacgtccgtggcacaggttatgactcaagaagtttttgagccatgc
gttcgtaatggacatggatga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000302
Entry
CpipJ_CPIJ000302  CDS       T01079                                 
Name
(GenBank) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ000302
   03420 Nucleotide excision repair
    CpipJ_CPIJ000302
   03430 Mismatch repair
    CpipJ_CPIJ000302
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ000302
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ000302
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ000302
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    CpipJ_CPIJ000302
  DNA Replication Termination Factors
   ELG1-RFC complex
    CpipJ_CPIJ000302
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    CpipJ_CPIJ000302
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     CpipJ_CPIJ000302
  Check point factors
   HRAD17(Rad24)-RFC complex
    CpipJ_CPIJ000302
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_22 AAA_16 Rad17 AAA_19 Viral_helicase1 AAA_18 Mg_chelatase AAA_5 AAA_assoc_2 AAA_24 RuvB_N AAA_11 MeaB AAA_25 NTPase_1 ABC_tran DEAD AAA_28 ResIII AAA_30 bpMoxR IstB_IS21 AAA_3 MipZ CbiA RNA_helicase SRP54 AAA_23 DNA_pol3_delta AAA_29 MCM AAA_7 GAIN
Other DBs
NCBI-ProteinID: EDS31728
VectorBase: CPIJ000302
UniProt: B0VZJ1
AA seq 344 aa
MPESQVNEGASGSGAAKDVAANKKKANLPWIEKYRPQKFEEIVGNEDTVSRLGVFATQGN
APNIIIAGPPGVGKTTTILCLARILLGENFREAVLELNASNERGIDVVRNKIKMFAQQKV
TLPRGRHKIVILDEADSMTEGAQQALRRTMEIYSNTTRFALACNTSEKIIEPIQSRCAML
RYSKLSDSQVLAKLIEICQKEALSYDEDGLEAIVFTAQGDMRQALNNLQSTANGFGHISG
ANVFKVCDEPHPMLVQDMLEHCVKGDVHKAYKIMAKLWRLGYAAEDIIGNIFRVCKRMNM
NEKLKLCFIREIGETHMKIVDGLNSLLQMSGLLAKLCEVSYDYS
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgccagaatctcaagttaacgaaggtgcttccggctccggagcagccaaggatgtggcc
gctaacaaaaagaaggccaatttgccatggatcgaaaagtaccgaccacaaaagtttgag
gaaatcgtcggcaatgaggacaccgtcagccggctgggcgtgtttgcgacccagggaaat
gcccccaacatcattattgcgggtcctcccggagtcggtaaaactacgaccatcctctgc
ctggctcgaatcctgctgggggaaaacttccgcgaagccgtgctcgagctgaacgcctcg
aatgagcgaggaatcgacgtggtgcgcaacaagatcaagatgttcgcccagcagaaggtt
acgctgccgcgaggtcgccacaagatcgtgatcctcgacgaggcggatagtatgactgag
ggtgcccagcaggccctccggcggacgatggaaatctacagcaacacgacgcgattcgcg
ttggcctgcaacaccagcgaaaagatcatcgaaccaattcagagtcgttgcgcgatgttg
cgatattcgaagctgtcggactcgcaggtgctggccaagttgattgagatttgccagaag
gaagcgctgagttacgacgaggatgggcttgaagcgattgtttttacggcccagggcgac
atgcggcaggcgctgaacaacctgcagtcaacggccaacggatttggccacatcagcggg
gcgaacgtgttcaaggtgtgcgacgagccgcacccgatgctggtgcaggacatgctcgag
cactgcgtcaagggggacgtccacaaggcgtacaaaatcatggcgaagctgtggcgcttg
ggctacgccgccgaggacatcatcgggaacatctttcgcgtgtgcaagcgcatgaacatg
aacgagaagctgaagctgtgctttatccgcgagattggcgaaacgcacatgaagatcgtg
gacgggctgaactcgctgctgcaaatgtccggcttgttggccaagctgtgcgaggtgtcg
tacgattactcgtaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001399
Entry
CpipJ_CPIJ001399  CDS       T01079                                 
Name
(GenBank) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ001399
   03420 Nucleotide excision repair
    CpipJ_CPIJ001399
   03430 Mismatch repair
    CpipJ_CPIJ001399
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ001399
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ001399
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ001399
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    CpipJ_CPIJ001399
  DNA Replication Termination Factors
   ELG1-RFC complex
    CpipJ_CPIJ001399
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    CpipJ_CPIJ001399
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     CpipJ_CPIJ001399
  Check point factors
   HRAD17(Rad24)-RFC complex
    CpipJ_CPIJ001399
SSDB
Motif
Pfam: AAA Rep_fac_C DNA_pol3_delta2 AAA_24 AAA_16 Rad17 AAA_11 AAA_assoc_2 AAA_22 AAA_19 Mg_chelatase AAA_30 AAA_14 bpMoxR AAA_5 DUF815 RuvB_N AAA_7 AAA_18 ResIII DUF2075 DUF3373 DNA_pol3_delta Penaeidin
Other DBs
NCBI-ProteinID: EDS31799
VectorBase: CPIJ001399
UniProt: B0W3L3
AA seq 355 aa
MHAFFKTGKAGDTTTGDGQPVEKRSKTHSVPWVEKYRPKNVDDVVEQGEVVAVLRESLST
ADLPNLLLYGPPGTGKTSTILAAARQLFGDMFKERILELNASDDRGIAVIRNKVKTFAQL
AASGTRPDGKPCPPFKIVILDEADAMTHAAQAALRRTMEKETKTTRFCLVCNYVSRIIEP
ITSRCTKFRFKPLRQEKIIERLRFICDQETVEVEDQAYQDIVDISGGDLRRAITTLQSCH
RLKGKEAKIEHSDILEMSGVVPRKYLEDFVSVCKTSNYSKLEDYVKGLTHDAYSVGQLFE
QLTDFIIMHEGLTDKQKSTICDKIGDCCFRLQGGGSEYIQIMDLGCVTIQALQAK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgcacgcatttttcaaaactggcaaagccggcgataccacaactggcgacggacaaccc
gtggaaaaacgcagcaagacacattccgtgccttgggttgaaaaatatcgaccaaagaat
gtggacgacgtggtggagcagggcgaggtagtggccgttttgcgcgaatctctgtcgacg
gccgatctgccgaatctgctgctgtacggaccgcctggaacgggtaaaaccagtacgatt
ttggcggcggcccgacagctgtttggggacatgttcaaggagcgcattctggagctaaac
gcctcggacgatcgcggtattgcggtcattcggaacaaggtgaaaacgtttgcccagttg
gctgccagcggaacccggccggacggaaagccgtgtccaccgttcaagatcgttatcctg
gacgaggccgatgccatgacccacgcggctcaggccgcgctccgccggacaatggagaaa
gaaaccaagacgacacggttctgcttggtttgtaattacgtgtctcggattatcgaaccg
atcacgtcgcgttgcaccaagttccggtttaagccgttgaggcaggaaaaaattatcgaa
cggttgcggttcatctgtgaccaggagacggtcgaggtggaggatcaggcgtaccaggac
attgtggatatttctggcggagatttgcgacgtgcgattaccacgctgcaatcgtgccac
cggttgaagggaaaggaggctaaaatcgaacactcggatatcctggagatgtcgggtgtg
gtcccgcggaagtacctggaagactttgtgtcggtgtgcaagacgtccaattacagcaag
cttgaggattacgtgaaaggtttgacccatgacgcgtacagcgtgggccagctgtttgag
cagctcacggattttattattatgcacgaaggactcactgataagcagaagagtacaatt
tgcgacaagattggggactgctgcttccgtcttcagggtggaggctcggaatacattcaa
attatggatctaggttgcgtcacgatccaggcattgcaagcaaagtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001914
Entry
CpipJ_CPIJ001914  CDS       T01079                                 
Name
(GenBank) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ001914
   03420 Nucleotide excision repair
    CpipJ_CPIJ001914
   03430 Mismatch repair
    CpipJ_CPIJ001914
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ001914
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ001914
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ001914
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    CpipJ_CPIJ001914
  DNA Replication Termination Factors
   ELG1-RFC complex
    CpipJ_CPIJ001914
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    CpipJ_CPIJ001914
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     CpipJ_CPIJ001914
  Check point factors
   HRAD17(Rad24)-RFC complex
    CpipJ_CPIJ001914
SSDB
Motif
Pfam: DNA_pol3_delta2 Rad17 Rep_fac_C DNA_pol3_delta AAA_16 AAA AAA_33
Other DBs
NCBI-ProteinID: EDS33902
VectorBase: CPIJ001914
UniProt: B0W4Q7
AA seq 358 aa
MALWVDRYRPRELAKLDYHKTQAGHLINLCAQGDFPHLMFYGPSGAGKKTRIMCLLRELY
GPGVERLRNEIMNFTTPSNKKVEIMTVSSNYHIEVNPSDAGIYDRVVITDMIKQIAQTQQ
IDPSGQREFKTIVLSEVDELTKDAQHALRRTMEKYVATCRLVLCVNSTSRVIPAVKSRCL
GIRVSAPTGEEIVGILNNICKKEGLHIPPELATRITQKSDRNLRRAILMLEACKVQQYPF
TVGQDVPEIDWQVFLRETANQIVQEQSPAKLEAVRERLYELLSQGVPSDVIFRGLVENLV
KNCDMSLKTQTLNFASLYEHRMQQGSKHIFHLEAFVAQFMALYKKFLNQASVMDMDDF
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggctctctgggttgatcggtaccgtccgcgcgagcttgccaagctagactaccacaaa
acgcaagcggggcacttgattaacctgtgcgcccagggcgacttcccgcatctgatgttc
tacggcccttccggagccggcaagaagacacggatcatgtgcctgctgcgggagctgtac
ggaccgggcgtggagcggctgcgcaacgaaatcatgaactttaccacaccgtcgaataag
aaggtggagattatgacggtgagcagcaactatcatattgaggtgaacccgtcggacgcg
gggatctacgaccgggtggtcatcacggatatgatcaagcagattgcccagacgcagcag
atcgatcccagtgggcagcgcgagtttaagacgatcgtgctgtccgaggtggacgagctg
acgaaggacgcccagcacgcgctccgacgaacgatggaaaagtacgtggcgacctgccgg
ttggtgctgtgtgtcaactccacgtcgcgcgtcattccggccgtcaagagtcgatgcttg
ggcattcgcgtgtcggcgccgaccggcgaggagattgtcggtattttgaataacatctgc
aagaaggagggtctccacattccgcctgagctggccacccgcatcacccagaagtcggac
cgcaacctgcgccgggccatcctgatgctggaggcgtgcaaggtgcagcagtatccgttc
accgtcggccaagacgtgccggagattgattggcaggtgttcctccgggagacggcgaac
cagatcgtgcaggagcagagtccggcaaagctggaagcggtccgggagcggctgtacgag
ctgttgtcgcagggcgtcccgtccgatgtgatattccgcgggttggtggagaatctggtc
aagaattgcgacatgagcctgaagacgcaaacgctcaactttgccagcttgtacgagcac
cggatgcagcagggcagcaagcacatcttccacctggaggcgttcgtggcgcagtttatg
gcgctgtacaagaagtttttgaaccaggcttcggtgatggatatggatgatttttga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014481
Entry
CpipJ_CPIJ014481  CDS       T01079                                 
Name
(GenBank) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ014481
   03420 Nucleotide excision repair
    CpipJ_CPIJ014481
   03430 Mismatch repair
    CpipJ_CPIJ014481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ014481
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ014481
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ014481
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    CpipJ_CPIJ014481
  DNA Replication Termination Factors
   ELG1-RFC complex
    CpipJ_CPIJ014481
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    CpipJ_CPIJ014481
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     CpipJ_CPIJ014481
  Check point factors
   HRAD17(Rad24)-RFC complex
    CpipJ_CPIJ014481
SSDB
Other DBs
NCBI-ProteinID: EDS40700
VectorBase: CPIJ014481
UniProt: B0X554
AA seq 223 aa
MKVSSNYHIEVNHSDAGIHDRITQTLQVDPGGQREFKTIVLSEVDQLTKDAQHVLRRTME
KYVATCRFLCVNSTSRVIPANSICKKEGIDIPPELATRITQKSDYNLRRAILMLEACKVQ
QYPFTVGQDLPEIDWQVFFRKMANQIVQEQSPQKLETNCDMSLKTQTLNFVQAPDAAGQQ
AHLPPGGVCGAVYGAVQEVFEPGFGDGTMTGLTVETTTMPFQL
NT seq 672 nt   +upstreamnt  +downstreamnt
atgaaggtgagcagcaactaccacatcgaggtgaatcattcggacgcgggaatccacgac
cggattacccagacgctgcaggttgatccgggcggacagagggagtttaagacgatcgtg
ctgtccgaggtggaccagctgacgaaggacgcccagcatgtgctcagacggacgatggaa
aagtacgtggccacatgccggtttctgtgcgtcaactccacgtcgcgcgtcattccggcc
aatagcatctgcaagaaggagggtatcgacattccgcccgagctggccacccgcatcacc
cagaagtcggactacaatctgcgccgggccatcctgatgctggaggcgtgcaaggttcag
cagtacccgttcaccgtcggccaagacttaccggagattgattggcaggtgttcttccgg
aagatggcgaaccagatcgtgcaggagcagagtccgcaaaagctggaaacgaactgcgac
atgagcctgaagacgcaaacgctcaactttgtacaagcaccggatgcagcaggacagcaa
gcacatcttccacctggaggcgtttgtggcgcagtttatggcgctgtacaagaagttttt
gaacccggcttcggtgatggaacgatgactggactgaccgtcgaaacaacaacgatgccg
tttcaattgtag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ017892
Entry
CpipJ_CPIJ017892  CDS       T01079                                 
Name
(GenBank) replication factor C large subunit
  KO
K10754  replication factor C subunit 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ017892
   03420 Nucleotide excision repair
    CpipJ_CPIJ017892
   03430 Mismatch repair
    CpipJ_CPIJ017892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ017892
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ017892
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    CpipJ_CPIJ017892
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     CpipJ_CPIJ017892
SSDB
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT Rad17 AAA_22 RuvB_N AAA_18 AAA_33 AAA_5 AAA_14 RNA_helicase AAA_16 AAA_17 AAA_30 BRCT_2 NTPase_1 AAA_assoc_2
Other DBs
NCBI-ProteinID: EDS26030
VectorBase: CPIJ017892
UniProt: B0XEK3
AA seq 1042 aa
MSKDIRSFFSVGGSKAKKPDPPRDSSSSSSKRKAVIVDSDEESTEHRKPSSSSSSSSKDK
SGHSKKRRVIDSDDEKSPVKKKVAPEPAAPKLKECKAEDFFGSAPVKRIETPRPSKKAVK
EEVAVHSDEEFEKSLSEMVVPETPPPPPAASKKKSEKVKSPAKNGGSGKEKNGHEESKKK
TPTPEKKSNGREEVKSTPPPAKKEKPASIKRESSAEQGTPKSTKKDLNESVLTDEERYER
KRMAAALYKKFQSRQGPANPGSKEIPKGTPTCLAGLQFVVTGVMESMERDECAQVIKDFG
GKVVTSVSKKLTHMVVGEDAGPSKLAKADELGIPQISEDQLFDLIRERSGLPVKAESKPK
VKEEKPKIKEEKSPSKEKKRTKTAEQEVKKRTPEKHKLSESVAKLPKIPKIEKRSPEQSK
PIKIEKKSPKKEPEMPPINREETAYQKDIQSTDNMAWVDKYKPTSIKQIIGQAGPASNVQ
KLLNWLSKWHSNHDGKKVLQRPSPWAKNDDGAYFKAALLSGPPGVGKTTTATLVCKELGF
DAVEFNASDTRSKKLLKEQVSELLTNKSLFGYFTGNGKGDKVTHKHVLVMDEVDGMAGNE
DRGGIQELIGLIKDSHVPIICMCNDRNHQKMRSLVNYCFDLRFNKPRVEQIKVRRHDVGL
LQGGLKLAPGALEEIIAGTGGDVRQTLNHLALHSTGKTLGGTSLSAAQAKQEAQTARKDV
KMGPWDVIRKVFSAEDHRTMSIHDKSDLFFHDYSLAPLFVQENYLKVTPKVPKAQHLDQI
ALAADSLSRGDLIDRRIRSSMAWSLLPMQAMFSSVLPGEYMEGNFTGQINFPGWLGKNSK
ASKRKRLAQEIHDHTRMSTSGSRLSVRLDYAPYLLGSIVRPLQQKGSEGVQESLDVIKEY
RLLREDLESLVELTSWPKKKSPMDAVDGKVKAALTRAYNKEVAPYTYSVVNAVKKKKSEA
ADDAAAEAYGEDAEEAGGAPDSEEEKEDDDLENNAFIKVKKKPAGKGAAATAGSSKAAGS
KGGSKAAKGGAGGSSSARGKKK
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgtccaaggacattcgctcgttcttctccgtcggcggttccaaggccaaaaagccggac
ccaccacgggacagctcgtcgtcgtcgtccaaacgcaaagccgtcatcgtcgacagcgac
gaagaatcgacggaacaccgtaaaccctcttcgtcctcttcctcctcctcgaaggacaag
tcgggccactcgaaaaagcgtcgcgtaatcgactcggatgatgagaagagtccggtcaag
aagaaggtcgcgccggagcctgcggctcccaagctgaaggagtgcaaggcggaggatttc
ttcgggtcggccccggtcaaacggatcgaaacgccgcgaccgagcaagaaagcggtgaag
gaggaggtggccgtgcattccgatgaggagtttgaaaagtcgctgagcgaaatggtcgtg
ccggagacgccgccgccgcctccggcggcatcgaagaagaagtcggagaaggttaaaagt
ccggcgaagaacggtggttctggaaaggagaagaatggtcacgaggaaagcaagaagaag
actccgacgccggagaagaagtcgaatggtcgcgaggaggtgaagagcacgccgcctccg
gcgaagaaggagaaaccggccagtattaagcgcgaatcgagcgcggagcagggaacgccg
aagagtacgaaaaaggacctgaacgaatcagttctgacggatgaggagcgttacgagcgg
aagcgcatggcagcggcgttgtacaaaaagtttcagagtcgtcaggggccggccaacccg
gggtcgaaggagattccaaagggaacgccgacatgcctcgccgggctgcagtttgtcgta
accggggtgatggagtcgatggagcgggacgagtgcgcccaggtcatcaaggactttggc
gggaaggtggtcacgtcggtgtccaagaagctcacgcacatggtcgtgggcgaagatgcg
ggaccttccaagttggccaaggcggacgagctcggaattccgcagattagcgaggaccag
ctgtttgatttgatccgcgagcggtccgggctgccagtcaaagcggagtccaagccaaag
gtcaaagaagagaagcctaaaatcaaggaggaaaagtcaccttccaaggagaagaagcgc
accaagaccgcagagcaggaggtcaagaaacgcacccccgaaaagcacaagctgtccgag
tcggtcgcgaagctcccaaaaattccaaagatcgagaagcgttccccagaacagtcaaaa
cccatcaagatcgagaagaaatcccccaaaaaggaaccggaaatgcccccaatcaaccgc
gaggaaaccgcctaccaaaaggacatccaaagcaccgacaacatggcctgggtggacaag
tacaaaccaacctcgatcaagcagatcatcggccaggccggccccgccagcaacgtccag
aagctgctcaactggctctccaagtggcactcgaatcacgacggcaaaaaggtgctccaa
cgccccagtccctgggccaaaaacgacgacggtgcctacttcaaagcagctctcctctcc
ggtcccccaggcgtcggcaaaaccaccacggccaccctcgtctgcaaggagctcggcttc
gacgcggtcgagttcaacgcgtccgacacgcgcagcaagaagctgctgaaggagcaggtc
tcggaactgctgacgaataaatcgctgtttggatattttaccggaaatgggaagggtgac
aaggtgacgcacaagcatgtgctggtgatggatgaggtcgacgggatggccgggaatgag
gatcgtggagggattcaggagctgattgggctgatcaaggatagtcacgtgccgattatt
tgcatgtgcaacgaccggaatcatcagaagatgcgctcgctggtgaactattgcttcgat
ttgcggttcaataagccgagggtggagcagattaaggttaggcgccatgatgtcggtctg
cttcaaggaggcctcaagctggccccgggcgcactggaggagatcatcgccggcaccgga
ggcgacgtccgtcaaacgctgaatcacctggcccttcacagcaccggtaagaccctgggt
gggaccagccttagcgccgcccaggccaaacaggaagcccaaacagcgcgcaaggacgtc
aagatgggcccgtgggacgtcatccggaaggtgttctccgccgaggatcaccgcaccatg
tccatccacgacaagtcggatctgttcttccacgattacagcctggcgccactttttgtg
caggagaactacttgaaggtcacgccgaaggttcccaaggcacagcacctggaccagatc
gcgctggccgcggacagtttgagccgcggggatttgatcgaccggcggatccgctcaagc
atggcgtggtcactgctgccaatgcaggccatgttcagctcggtcctgcccggtgagtac
atggagggtaacttcaccggccagatcaactttcccggatggttgggtaaaaactcgaag
gcctccaagcggaagcgtctggcgcaggagatccacgaccacacccgcatgagcacctcc
ggttcgcgactgtccgtccggctggactacgctccgtacctgctcgggtcgatcgtgcgt
ccgctgcagcagaaaggctcggaaggagtgcaggaatctctggacgtcatcaaggagtac
cgcctgctgcgggaggatctggaatcgctggtcgaactcacgagctggcccaagaagaag
agcccgatggacgccgtcgatgggaaggtaaaggcagcgctcacccgagcctacaacaag
gaggtggccccgtacacgtactcggtcgtcaacgcggtgaagaagaagaagtcggaagcc
gcggacgatgcggcggctgaggcatacggagaggatgctgaggaggcgggtggtgcgccg
gattcggaggaggaaaaggaggacgacgatctggagaacaatgcgttcatcaaggtgaag
aagaagccggcgggtaagggagcggcggcgacagctggaagcagcaaggcagcgggatcg
aagggtggttccaaggcggcgaagggtggagcaggtggctcgtcgtcggctaggggaaag
aaaaagtaa

DBGET integrated database retrieval system