KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ000871
Entry
CpipJ_CPIJ000871  CDS       T01079                                 
Name
(GenBank) crossover junction endonuclease MUS81
  KO
K08991  crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ000871
   03460 Fanconi anemia pathway
    CpipJ_CPIJ000871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ000871
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-
     CpipJ_CPIJ000871
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     CpipJ_CPIJ000871
SSDB
Motif
Pfam: ERCC4 PGI
Other DBs
NCBI-ProteinID: EDS44980
VectorBase: CPIJ000871
UniProt: B0W1B0
AA seq 450 aa
MPKQNSNLRLRIVRNAETDTTQPSTKRARIAVRMHHPNPLFERWLQEMIAKAEERNTMGR
IPLQKALESLRMFPLPLASGRDCFILAHFGRTICEALDQKLRAYVANVGETLGSCREVVE
RMLNDRGQGHYRELVRVLGEEEEVVAAAEVEYELPEDLDLGDTEDEMEPCPGTSSEPTDQ
VVNIRDPKVILLVDTAETIGKSKSNLDRTLKALQQNHVEHEVRRLSVGDFLWIVRDDTGV
DSIKDGRFHEQKFRLKQCGLANVIYLIEHLGNNRQVGVPASTLSQAALNTFVQDFTVKYT
ENHLHTVLYLATMTGLLGKNVKNKTFQNITNLPAEQLVEVTKDFNLSQSTIPLIAFETFN
KQSSKTRACTVKEVFMKQLLQVKLLTIEKVNAIVERYPTPRKLFLAFERCTSEAEKERLL
NLPYGPAKRNIGLKLSKIVYQLFMSDVYQR
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcctaagcaaaactccaacctgcgcctccgaatcgtccggaacgccgaaaccgacacc
actcaaccgtccacgaaacgcgcccgtatcgcggtccggatgcaccacccgaacccgctg
ttcgaacgatggctccaggagatgatcgccaaggccgaggagcggaacacgatgggccgg
attccgctccagaaggcgctggaatcgctgcggatgttcccgctgccgttggcctccggc
cgggactgcttcattttggcgcactttggccgaacgatttgcgaggcgttggaccagaag
ctgcgagcatacgtggcgaatgttggggagacgttgggaagctgccgggaggttgtggag
cggatgctgaacgatcgggggcaggggcattaccgggagttggtgagggtgttgggagag
gaggaggaagttgtggctgcggctgaggtggagtacgagttgccggaggatttggatttg
ggcgatacggaggacgaaatggaaccgtgtcctggaacgagttcagagcctacggatcag
gttgttaacattcgggatcccaaggtgattctgctggtggacacggcggaaacgattggc
aagtcaaagagcaacctggatcgaacacttaaagcgctgcagcagaatcacgtcgagcac
gaggttcgccggctcagcgttggggactttttgtggattgtccgggatgacactggcgtg
gacagcatcaaggacggtcgctttcacgagcaaaagtttcgcctcaagcagtgtggcctc
gccaatgtaatatacttgattgaacacctgggaaacaatcggcaggttggagttccggcc
agtaccttgtcgcaggcggccctcaacacgttcgtgcaggacttcaccgtgaagtatacg
gagaatcatctgcacacggtgctgtatctggccacgatgaccggcttgttgggcaagaat
gtgaagaacaaaaccttccagaacatcaccaaccttcccgcggaacaactcgtcgaagta
acgaaagactttaacctcagccaatccaccatcccgctcatcgccttcgaaaccttcaac
aaacagtcgtccaagacgcgcgcctgcacggtgaaggaagtcttcatgaagcagctgctc
caggtcaagctgctcacaatcgagaaggtaaacgctatcgtggaacgttatccgacgccc
cgcaagctgttcctcgccttcgaacgctgcaccagtgaagccgagaaggaacgcctgctg
aacctaccctacggaccggccaaaaggaacatcggattgaagctgagtaaaatcgtctac
cagctgttcatgagcgatgtctaccagcggtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ020282
Entry
CpipJ_CPIJ020282  CDS       T01079                                 
Name
(GenBank) crossover junction endonuclease MUS81
  KO
K08991  crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ020282
   03460 Fanconi anemia pathway
    CpipJ_CPIJ020282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ020282
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-
     CpipJ_CPIJ020282
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     CpipJ_CPIJ020282
SSDB
Motif
Pfam: ERCC4 PGI
Other DBs
NCBI-ProteinID: EDS34247
VectorBase: CPIJ020282
UniProt: B0XLJ7
AA seq 450 aa
MPKQNSNLRLRIVRNAETDTTQPSTKRARIAVRMHHPNPLFERWLQEMIAKAEERNTMGR
IPLQKALESLRMFPLPLASGRDCFILAHFGRTICEALDQKLRAYVANGGETLGSCREVVE
RVLNDRGQGHYRELVRVLGEEEEVVAAAEVEYQLPEDLDLGDTEDEMEPCPGTSSEPTEQ
VVNIRDPKVILLVDTAETIGKSKSNLDRTLKALQQNHVEHEVRRLSVGDFLWIVRDDTGV
DSIKDGRFHEQKFRLKQCGLANVIYLIEHLGNNRQVGVPASTLSQAALNTFVQDFTVKYT
ENHLHTVLYLATMTGLLGKNVKNKTFQNITNLPAEQLVEVTKDFNLSQSTIPLIAFETFN
KQSSKTRACTVKEVFMKQLLQVKLLTIEKVNAIVERYPTPRKLFLAFERCTSEAEKERLL
NLPYGPAKRNIGLKLSKIVYQLFMSDVYQR
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcccaagcaaaactccaacctgcgcctccgaatcgtccggaacgccgaaaccgacacc
actcaaccgtccacgaaacgcgcccgtatcgcggtccggatgcaccacccgaacccgctg
ttcgaacgatggctccaggagatgatcgccaaggccgaggagcggaacacgatgggccgg
attccgctgcagaaggcgctggaatcgctgcggatgttcccgctgccgttggcctccggc
cgggactgcttcattttggcgcactttggccgaacgatttgcgaggcgttggaccagaag
ctgcgagcgtacgtggcgaatggtggggagacgttgggaagctgccgggaggttgtggaa
cgggtgctgaacgatcgggggcaggggcattaccgggagttggtgagggtgttgggagag
gaggaggaagttgtggctgcggctgaggtggagtaccagttgccggaggatttggatttg
ggcgatacggaggacgaaatggaaccgtgtcctggaacgagttcagagcccacggagcag
gttgttaacattcgggatcccaaggtgattctgctggtggacacggcggaaacgattggc
aagtccaagagcaacctggatcgaacacttaaagcgctgcagcagaatcacgtcgagcac
gaggttcgccggctgagcgttggggactttttgtggattgtccgggatgacactggcgtg
gacagcatcaaggacggtcgctttcacgagcaaaagtttcgcctcaagcagtgtggcctc
gccaatgtaatatatttgattgaacacctgggaaacaatcggcaggttggagttccggcc
agtaccttgtcgcaggcggccctcaacacgttcgtgcaggacttcaccgtgaagtatacg
gagaatcatctgcacacggtgctgtatctggccacgatgaccggcttgttgggcaagaat
gtgaagaacaaaaccttccagaacatcaccaaccttcccgcggaacaactcgtcgaagta
acgaaagactttaacctcagccaatccaccatcccgctcatcgccttcgaaacctttaac
aaacagtcgtccaagacgcgcgcctgcacggtgaaggaagtcttcatgaagcagctgctc
caggtcaagctgctcacaatcgagaaggtaaacgccatcgtggaacgttatccgacgccc
cgcaagctgttcctcgccttcgaacgctgcaccagtgaagccgagaaggaacgcctgctg
aacctaccctacggaccggccaaaaggaacatcggattgaagctgagtaaaatcgtctac
cagctgttcatgagcgatgtctaccagcggtga

DBGET integrated database retrieval system