KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001067
Entry
CpipJ_CPIJ001067  CDS       T01079                                 
Name
(GenBank) E3 ubiquitin-protein ligase FANCL
  KO
K10606  E3 ubiquitin-protein ligase FANCL [EC:2.3.2.27]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
cqu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ001067
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ001067
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ001067
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ001067
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     CpipJ_CPIJ001067
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    CpipJ_CPIJ001067
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     CpipJ_CPIJ001067
SSDB
Motif
Pfam: FANCL_d3 FANCL_C zf-RING_2 zf-HC5HC2H zf-RING-like PHD zf-ANAPC11 zf-HC5HC2H_2 zf-rbx1 RINGv PHD_2 zf-RING_16
Other DBs
NCBI-ProteinID: EDS27438
VectorBase: CPIJ001067
UniProt: B0W202
AA seq 318 aa
MKIAVFDALQLVNTEEVSKNGSLDEYMENLINFLTGRTTPPAKESNPDASAILAILSQLE
QLKKEHHCQVHINSSLSQLKLSRFKGDDQHFLELARASETTFSVISHSLPDLGSSVELFM
YPAAPEAHTTQFVRVLEQLEEFYSNLNTLDQLCYVVDPTEVDTRLTWRIIKFSQKVFLKI
SLHPLQPSSIEVAFIGPTDEIELLREQYNGKLEDWDPDSDVYTNMLRIFEIMSFPMRTDD
EADAIDCGICMSHRDERGKIPIVSCDNEKCSLVFHIDCMKQWFLSLKESKTFFAISIGTC
PYCKQKLSSSFDMLLRCL
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaaaattgctgttttcgatgcgttgcaattagtgaacactgaagaggtttccaaaaac
ggctcactcgatgaatacatggaaaatttgataaacttcctaactggtagaactacgcca
ccagcgaaagagtccaatccggatgcttccgccatcctggccatcttgagccaacttgaa
cagctgaaaaaggagcaccattgccaagtgcacatcaacagctcgctttcgcagcttaaa
ttatctagattcaaaggggacgatcaacattttttagaattggcacgagcctccgagacg
accttctcggtcatttcgcacagtttgccggatttgggttcgtccgtggagctcttcatg
taccctgcggcaccggaagcgcacaccacgcaattcgttcgagttttagagcagctcgaa
gaattctacagcaacctcaacacactcgatcagctttgctacgtggtagatccgacggag
gttgacacgcgcctcacatggcgcatcatcaagttcagccaaaaggtgttcctaaagatt
tcgctgcaccctctgcagccgtcctcgatcgaggttgcgttcatcgggccaacggacgag
attgaactgctgcgagagcagtacaacggcaagctggaggactgggatccggacagcgac
gtgtacacgaacatgctgcgaattttcgagatcatgtcgtttccgatgcgcaccgatgac
gaggcggacgcgatcgactgtggcatctgtatgtcgcaccgggacgagaggggcaagatt
ccgatcgtcagctgtgacaacgaaaagtgctcgctggtgtttcacatcgattgtatgaag
cagtggttcctatcgttgaaggaaagcaaaactttcttcgccatatccatcggaacgtgt
ccttattgtaagcaaaagttgtcatcgagcttcgatatgctgctgagatgtttgtga

DBGET integrated database retrieval system