KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001341
Entry
CpipJ_CPIJ001341  CDS       T01079                                 
Name
(GenBank) RAD51C protein
  KO
K10870  RAD51-like protein 2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ001341
   03460 Fanconi anemia pathway
    CpipJ_CPIJ001341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ001341
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     CpipJ_CPIJ001341
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     CpipJ_CPIJ001341
SSDB
Motif
Pfam: Rad51 AAA_25 AAA_22 RecA AAA_11 AAA_33 AAA_24
Other DBs
NCBI-ProteinID: EDS30743
VectorBase: CPIJ001341
UniProt: B0W335
AA seq 274 aa
MFTKTCADLLQQEARLPGIITFCKDLDHAIGHPGVSVGLITEFCGPPGSGKTQILQLCVN
ANLPKELGGLGGKSLYLDTNFGFSPDRLREIATACVQHCQRIVRTSRPQLAEVTSKFTAE
SVMESVLYNHVHVCNDLNKSIDTLERLLKLGEKIRLVVIDSYSFLIRCNIENTLERIRID
HTVLNRLQILAQQFKFAIVLTNDVTTKLNGTDPSTIAPALGDSHGHRINQRIVLGQTGSE
PGMFVASVEKGFHRPRMAVKFQISSAGVRGVRKK
NT seq 825 nt   +upstreamnt  +downstreamnt
atgttcaccaaaacgtgcgccgacttgctgcagcaggaagcccgactgcccggcatcata
acgttctgcaaggacctggaccacgcaattggccatcctggcgtgtccgttggcctgatt
acggagttttgcggaccaccgggcagtggcaagacgcaaattttacagctctgcgtgaac
gccaaccttccgaaagagcttggaggtctcggaggaaagtcactttaccttgacacgaat
ttcggttttagtcccgatagattgagagaaattgcaacagcatgtgttcagcattgccaa
agaatcgtccgtactagcagaccgcagctggcggaagttacctcgaaatttaccgcggaa
agtgttatggaaagtgtgctctacaatcacgtgcacgtttgtaatgatttaaacaaaagt
attgacacgctggagaggctactcaaattaggggagaagattcgactcgtcgtaatagat
tcgtactcgtttctgataagatgcaacattgagaataccttggaacgaatccggatagac
cacacggtattaaacagattgcagattctcgctcagcagttcaagtttgcaatcgtccta
acaaacgacgtgaccaccaaacttaacggcaccgatccgagcacgattgccccggccctt
ggtgacagccacggccaccggatcaaccagcggattgtccttgggcaaaccggcagcgag
cccggcatgtttgtggcttccgttgagaagggcttccatcggcctcggatggcggtcaaa
tttcaaatcagctcagccggagtgcggggagttcggaaaaagtaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018012
Entry
CpipJ_CPIJ018012  CDS       T01079                                 
Name
(GenBank) RAD51C protein
  KO
K10870  RAD51-like protein 2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ018012
   03460 Fanconi anemia pathway
    CpipJ_CPIJ018012
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ018012
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     CpipJ_CPIJ018012
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     CpipJ_CPIJ018012
SSDB
Motif
Pfam: Rad51 AAA_25 RecA AAA_11 AAA_22 ATPase AAA_24 AAA AAA_33 Zot AAA_18 DnaB_C
Other DBs
NCBI-ProteinID: EDS27895
VectorBase: CPIJ018012
UniProt: B0XGX6
AA seq 275 aa
MFTKTCADLLPQEARLPGIITFCKDLDHAIGHPGVSVGLITEFCGPPGSGKTQMCLQLCV
NANLPKELGGLGGKSLYLDTNFGFSPDRLREIATACVQHCQRIVRTSRPQLAEVTSKFTA
ESVMESVLYNHVHVCNDLNKSIDTLERLLKLGEKIRLVVIDSYSFLIRCNIENTLERIRI
DHTVLNRLQILAQQFKFAIVLTNDVTTKLNGTDPSTIAPALGDSHGHRINQRIVLGQTGS
EPGMFVASVEKGFHRPRMAVKFQISSAGVRGVRKK
NT seq 828 nt   +upstreamnt  +downstreamnt
atgttcaccaaaacgtgcgccgatttgctgccgcaggaagcccgactgcccggcatcata
acgttctgcaaggacctggaccacgcaattggccatcctggcgtgtccgttggcctgatt
acggagttttgcggaccaccgggcagtggcaagacgcaaatgtgtttacagctctgcgtg
aacgccaaccttccgaaagagcttggaggtctcggagggaagtcactttaccttgacacg
aatttcggttttagtcccgatagattaagagaaattgcaacagcatgtgttcagcattgc
caaagaatcgtccgtactagcagaccgcagctggcggaagttacctcgaaatttaccgcg
gaaagtgttatggaaagtgtgctctacaatcacgtgcacgtttgtaatgatttaaacaaa
agtattgacacgctggagaggctactcaaattaggggagaagattcgactcgtcgtaata
gattcgtactcgtttctgataagatgcaacattgagaataccttggaacgaatccggata
gaccacacggtattaaacagattgcagattctcgctcagcagttcaagtttgcaatcgtc
ctaacaaacgacgtgaccaccaaacttaacggcaccgatccgagcacgattgccccggcc
cttggtgacagccacggccaccggatcaaccagcggattgtccttgggcaaaccggcagc
gagcccggcatgtttgtggcttccgttgagaagggcttccatcggcctcggatggcggtc
aaatttcaaatcagctcagccggagtgcggggagttcggaaaaagtaa

DBGET integrated database retrieval system