KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ001565
Entry
CpipJ_CPIJ001565  CDS       T01079                                 
Name
(GenBank) CDK-activating kinase assembly factor MAT1
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ001565
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ001565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ001565
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ001565
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ001565
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ001565
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-RING_UBOX zf-RING_5 zf-UDP zf-C3HC4 zf-RING_2 zf-C3HC4_2 Mitovir_RNA_pol DUF273 Prok-RING_4 zf-RING_4 zf-P11
Other DBs
NCBI-ProteinID: EDS30324
VectorBase: CPIJ001565
UniProt: B0W2W5
AA seq 312 aa
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVELLFLKGSGSCPECNVALRRSNFRV
QLFEDSNVDKEVQIRKRILKDFNKKEDDFNSLAEYNDYLEMIEEIVFNLCNNIDIINTNK
RIEQYKKENRDVILKNKTKLSKDEIELEELIEVEKEQTDQRKKELAMMEAENRKQKAKNK
EDLIDSLMASYEDASAIVDKFAQRAEKQHIPLPKPMAPPPPKTTHFSTGIKFQSQHGFLP
VPRIEEGPTYVYEAQVFPKEGPMPPALADIGSNGYIKHIRAETLGERAGGFQTNISCLRA
IQEALVGLYHGC
NT seq 939 nt   +upstreamnt  +downstreamnt
atggacgatcaaggatgtccccgttgcaaaaccacaaagtaccgaaatccgtcgctcaag
ctgatggtcaacgtttgcggtcacacgctctgcgaaagttgcgtcgagttgctcttcttg
aagggttccggttcgtgtcccgagtgtaatgttgcgttgcgtcggagtaatttccgagtt
cagttgtttgaggattccaacgtcgacaaggaggttcagattcggaagaggattctcaag
gatttcaacaagaaagaggacgattttaactcgctggccgaatacaacgattatctggag
atgattgaggagattgtgtttaatttgtgcaacaacatcgacatcataaacacaaacaag
cgaatcgagcagtacaagaaggagaatcgcgacgtaattctcaaaaacaagaccaaactg
agcaaggatgagatcgagctggaggagctgattgaggtagagaaggagcaaacggaccaa
cggaagaaggaactggccatgatggaggcggagaatcgcaagcagaaggcgaagaacaag
gaagatttgattgattcgctgatggccagttacgaagatgccagcgccatcgtggacaaa
tttgcccagcgcgccgaaaagcagcacattcccctgcccaaaccgatggccccgccgcca
ccgaagacaacccacttttcgaccggaatcaagttccagtcccagcacgggttcctgccg
gtgccgagaatcgaggaaggacccacgtacgtgtacgaggcgcaagtcttccccaaggag
ggtccgatgccaccggcgctggcggacattggtagcaacgggtacatcaagcacatccgg
gcggaaacgttgggcgagcgagccggcggattccagacgaacatttcctgtttgcgggct
attcaggaagcgctcgttgggttgtatcacggttgttga

DBGET integrated database retrieval system