KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002381
Entry
CpipJ_CPIJ002381  CDS       T01079                                 
Name
(GenBank) replication protein A 70 kDa DNA-binding subunit
  KO
K07466  replication factor A1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ002381
   03420 Nucleotide excision repair
    CpipJ_CPIJ002381
   03430 Mismatch repair
    CpipJ_CPIJ002381
   03440 Homologous recombination
    CpipJ_CPIJ002381
   03460 Fanconi anemia pathway
    CpipJ_CPIJ002381
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cqu03000]
    CpipJ_CPIJ002381
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ002381
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ002381
Transcription factors [BR:cqu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    CpipJ_CPIJ002381
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CpipJ_CPIJ002381
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CpipJ_CPIJ002381
   MMR (mismatch excision repair)
     CpipJ_CPIJ002381
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CpipJ_CPIJ002381
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon DUF223 IBR
Other DBs
NCBI-ProteinID: EDS35978
VectorBase: CPIJ002381
UniProt: B0W5Z1
AA seq 615 aa
MSFNGLLSTGCIAEIMRGVEMEKSVVQILGSKRIAGSGEQAERYRLLISDGQYLYSFAML
ATQLNEMHHSGQLAEFTVIRIDRFITSVVNRNERGEKRVLIILDLTVVKPGSAVGVKIGN
PQPLTEGGNPSGGAASSGAPTRTESAGAVSNGSSYQNRLNSSVSASNSTQSSLQESLTHP
INSLSPYQNKWVIKARVMSKSAIRTWSNAKGEGKLFSMDIMDESGEIRVTAFKEQCDKFY
DMIEADKVYYITKCQLKPANKQYSTLKNDYEMTMSNETIIQECKDVDASMPGIQYNFVPI
SQITNMEPNAMIDVVGVCKEASELNTFTAKSSGRELTKREVTMVDSSNAAVQLTLWGADA
QNFPTSTNPVVVVKGARVTEFGGGKSLGLVGGSVMKLNPDIDVAHKIRGWYDNGGCDAVI
NSVSTRTGAAGGSYSTEWMTFHETKEKNLGHGDKPDYFQVKALVHNIKSGNAVYKACPQT
DCNKKVVDQDNGQYRCEKCNADFPNFKYRLLVNMLVGDWTSNRWVTVFTELGEQMLGKTS
QEIGDALEYNKDEAEQIFSNISFASFIFKLRTKVEFYGDAARNKTTAVAATPVNHKEYNA
YLVKNIQELTGIGKN
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgagcttcaacgggctgctatcgactggctgcattgctgaaataatgcgcggtgtcgag
atggaaaagtcggtggtgcagattctgggctcgaagcggatcgccggcagtggcgaacag
gccgagcggtaccggctgctcatctcggacggtcagtacctgtacagtttcgcgatgttg
gcgacccagctgaacgagatgcaccactcgggtcagctggcagagtttaccgttatccgg
attgatcggttcatcacgtcggtcgtgaaccggaacgagcggggcgagaagcgagtgttg
attattttggacttgacggtggtgaagccgggatctgcggttggggtgaagattggcaat
ccacagccgctgacggagggcggaaatccgagcggaggggcggccagttcgggtgctccg
actaggacagagtcggccggagctgtgagcaacgggtcgtcgtaccagaatcgtctcaac
agtagcgttagtgcgtccaacagtacgcagagctcgctgcaggaatcgttgacccatccg
atcaactcgctgagtccgtaccagaacaagtgggtcatcaaggcgcgagtcatgtccaag
tcggcgatccgcacctggagcaatgccaagggcgaaggcaagctcttctcgatggacatt
atggacgagtcaggtgaaattcgcgtgaccgcgttcaaggagcagtgcgacaaattctac
gacatgattgaagcggacaaagtctattacattacaaagtgtcagctgaagccggccaac
aagcagtactcgacgttgaagaacgactacgagatgaccatgtcaaacgaaacgatcatt
caggagtgcaaggatgtggacgcgtccatgcccggtatccagtacaactttgtgcccatt
tcgcagattaccaacatggaaccgaacgccatgattgatgtggtcggtgtctgcaaggaa
gcgagcgagttgaacacattcacggccaaatcttccggtcgtgagctgaccaaacgtgaa
gtcacaatggtggactccagcaacgccgcagtccaactgaccctctggggcgccgatgcc
caaaacttccccacctcgacgaacccggtagtcgtggtcaagggagctcgcgtgaccgaa
ttcggcggaggaaaatccctcggtctggtcggaggcagcgtaatgaaactgaacccggac
attgacgtcgctcacaagattcgcggctggtacgacaacggaggctgcgacgccgtcatc
aacagcgtttccacccgaaccggtgccgctggcggttcgtactcgaccgagtggatgacg
ttccacgaaaccaaggagaagaacctgggtcacggggacaagccggattacttccaggtg
aaggccctggtacacaacatcaagtcgggcaacgccgtctacaaggcgtgcccacaaacc
gactgcaacaagaaagtggtcgaccaggacaacggacagtaccggtgcgaaaagtgcaac
gccgattttcccaacttcaagtaccggctgctggttaatatgctggttggcgattggacc
tcgaaccgctgggtgacggtcttcaccgagctgggcgaacagatgctgggcaagacgtcg
caggaaattggcgatgcgctcgagtacaacaaagacgaggccgaacaaattttctccaac
atcagcttcgcgagcttcatcttcaagttgcgcaccaaggtcgagttttacggcgatgcg
gcccgcaacaaaaccaccgccgtggcggccacccccgtcaaccacaaggagtacaacgca
tacctggtcaagaacatccaggagctgaccggcatcggcaagaactaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003130
Entry
CpipJ_CPIJ003130  CDS       T01079                                 
Name
(GenBank) replication factor A, 14kD-subunit
  KO
K10740  replication factor A3
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ003130
   03420 Nucleotide excision repair
    CpipJ_CPIJ003130
   03430 Mismatch repair
    CpipJ_CPIJ003130
   03440 Homologous recombination
    CpipJ_CPIJ003130
   03460 Fanconi anemia pathway
    CpipJ_CPIJ003130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ003130
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003130
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CpipJ_CPIJ003130
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CpipJ_CPIJ003130
   MMR (mismatch excision repair)
     CpipJ_CPIJ003130
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CpipJ_CPIJ003130
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-ProteinID: EDS37306
VectorBase: CPIJ003130
UniProt: B0W732
AA seq 114 aa
MDFEPRTIVNGAQLKHHPGKAVSIHLFVDRAETDGRSFTGRSSDGLNIQVVLSQPLSELL
HGWVEVIGMAGSNESVRCKEIITYKETEESAFDAFGHDALCTFLANCKDIFQMS
NT seq 345 nt   +upstreamnt  +downstreamnt
atggactttgaaccgcgtacgatcgtaaacggtgcccagctgaagcaccacccgggcaag
gcggtcagcatccacctgtttgtggaccgcgccgaaacggacggacgcagcttcactggc
cgttccagcgacgggctgaacatccaggtcgtgctgtcccagccactgagcgagctgctg
cacggctgggtcgaggtcatcgggatggccggctccaacgagagcgtgcggtgcaaggag
attatcacctacaaggagacggaggagagcgcgtttgatgcgtttggccacgacgcgctt
tgtacgtttctggccaactgcaaagacatcttccaaatgtcctag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006417
Entry
CpipJ_CPIJ006417  CDS       T01079                                 
Name
(GenBank) insect replication protein a
  KO
K10739  replication factor A2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ006417
   03420 Nucleotide excision repair
    CpipJ_CPIJ006417
   03430 Mismatch repair
    CpipJ_CPIJ006417
   03440 Homologous recombination
    CpipJ_CPIJ006417
   03460 Fanconi anemia pathway
    CpipJ_CPIJ006417
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ006417
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ006417
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CpipJ_CPIJ006417
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CpipJ_CPIJ006417
   MMR (mismatch excision repair)
     CpipJ_CPIJ006417
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CpipJ_CPIJ006417
SSDB
Motif
Pfam: RPA_C MarR MarR_2 SelB-wing_2 DUF438
Other DBs
NCBI-ProteinID: EDS28014
VectorBase: CPIJ006417
UniProt: B0WHV6
AA seq 242 aa
MNFSTGSDTFNPRSARGANDEHKSEGVLPVMLRHIQESPEEGIELFGYQYATVTFVAIVR
QIVQTPTKVTYRMEDHTAQLDAHRWIDEEHPDQNDIPVVRINSYARVVGSVRNEGKGSDR
VKAVMIFKISQVDSPNEITTHLLEVLNARYKGEEYAKKAGISGIGGSREEIAEANSMGLS
RAQMVVYKAIKHHISDIGISREELQAKFPHISPTEMTRIIDEMIQEGLVYTSADVDHFLC
VT
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaactttagcaccggttccgacacgttcaacccgcgctcggcgcgtggcgccaacgac
gagcacaaatcggagggcgtgcttccggtgatgctgcgtcacatccaggagtcgcccgag
gagggcatcgagctgttcggctaccagtacgcaacggtgacgttcgtagcaatagtccgg
caaatcgtccaaaccccgacgaaggtcacgtaccggatggaggaccacactgcccagctc
gatgcgcatcgctggattgatgaagagcatccggaccagaacgacattccggtggtccgt
attaacagttacgcgcgggtggttggctccgtgcgcaacgagggcaagggcagtgacaga
gtgaaggcggttatgatcttcaagatctcgcaggtcgattcgccgaatgagatcacgacg
cacctgctggaggtgttgaacgcccggtataaaggagaagagtacgcaaagaaagccgga
atcagcggaatcggtggctccagagaagaaatcgccgaagcaaactcgatggggctgtcc
agagcgcagatggtcgtttacaaggccatcaaacatcacatatcggacattgggatcagc
cgagaggagctgcaggccaaattcccgcacattagcccgacggagatgacgagaataatc
gatgagatgattcaggagggcctcgtttataccagcgcggacgtcgatcacttcctgtgc
gttacgtaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006691
Entry
CpipJ_CPIJ006691  CDS       T01079                                 
Name
(GenBank) insect replication protein a
  KO
K10739  replication factor A2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ006691
   03420 Nucleotide excision repair
    CpipJ_CPIJ006691
   03430 Mismatch repair
    CpipJ_CPIJ006691
   03440 Homologous recombination
    CpipJ_CPIJ006691
   03460 Fanconi anemia pathway
    CpipJ_CPIJ006691
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ006691
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ006691
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CpipJ_CPIJ006691
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CpipJ_CPIJ006691
   MMR (mismatch excision repair)
     CpipJ_CPIJ006691
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CpipJ_CPIJ006691
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon Rtt106 SelB-wing_2 CDC24_OB3 RMI2
Other DBs
NCBI-ProteinID: EDS27932
VectorBase: CPIJ006691
UniProt: B0WHR5
AA seq 248 aa
MNDSFGGGGFNASSAGGAKDENKAEGVLPLMVRHILESSEAGIQLFGFQYAMVTFVGIVR
HIDHSSTKVTYRVEDHTGQVDAHLWLEEGDNMNIPGVLINTYVRIVGSVRSQGGSKAVMI
FKIAQIDSPNEVTTHLLEVLNARYKGEAYAKSAGIAGGAREGGSGEGSASGGGFMDNEAN
SMGLSGKQLVVYKAIKSHMSDIGISRKELQSKFPHISPSEMQSITDYMTQEGIVYTSVDS
DHFLCVDS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaacgatagcttcggcggcggcggcttcaacgcgtcctcggccggtggcgccaaggac
gagaacaaagcggagggcgttctgccgctgatggtgcgccacatcttggaatcgtccgag
gcgggcatccagctgtttggcttccagtacgccatggtcacgttcgtgggcatcgtgcgg
cacattgaccactcctcgacgaaggtcacgtaccgggtggaggaccacaccggccaggtc
gatgcgcacctctggctggaggaaggggacaacatgaacatcccgggggtcttgattaac
acgtacgtgcggattgttggttccgtgcgctcccagggcggctcgaaggcggtgatgatc
ttcaagattgcgcagatcgattcgccgaacgaggtgacgacgcacctgctggaggtgttg
aacgcccggtacaagggcgaagcgtacgccaagagtgccggaattgcgggaggggctcgg
gagggtggttccggagagggaagcgccagcggcggtggcttcatggacaacgaagcgaac
tcgatggggctgtccgggaagcagctggtcgtttacaaggccatcaagagtcacatgtcg
gacattggcatcagccgaaaggagctgcagtccaagttcccgcacattagcccgtcggag
atgcagagcatcaccgattacatgacccaggagggcatcgtgtacaccagcgtggactcg
gaccacttcctgtgcgttgattcgtaa

DBGET integrated database retrieval system