KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002521
Entry
CpipJ_CPIJ002521  CDS       T01079                                 
Name
(GenBank) esr1 protein
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
cqu04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ002521
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ002521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ002521
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ002521
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CpipJ_CPIJ002521
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   CpipJ_CPIJ002521
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    CpipJ_CPIJ002521
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC
Other DBs
NCBI-ProteinID: EDS36403
VectorBase: CPIJ002521
UniProt: B0W656
AA seq 2556 aa
MEVDDVATGGLSPKEQKNKSDQMWETLTTTFAENVRNRSSHLEQILCMIKDNLTYDDPGL
FPSYLIHQDDEREQVKAHNFWLLNQLIQISAMPDYFNIKKSNTDLQQTILAASYLKQLWF
FYEAGSKYLEMLEQLNQIGPADSEVNVQLKTFHMPDSVFRRIECSCVIEPIVVPDVPTKI
KLIENSLHILSQLVSLEDEQANRPFRERCASSVLNTLTHGSLNEKSLCLLFFVKYFKKVA
EFTPDLERLVLEVLIVVDVTLERSDRWLRSEIIKPKALEKFKSTLMSFYARVNGISFNNS
CTENRKKMVSCSIRIVKTLLTTKKDTGGSILDLLEQIKRFLRILLNHDESLAVEDELSDV
LQIARKFPELLNILEVPITNELIASDDSNETDVRQLSHIWKNVYEISEDQKLTDSQKVVI
KQKTIRIAFNVNHNISLWMQKQIPTPANKLSFFGGCLADLLQQLFENVQKSPVSIEAVLA
VLDICFDVAYLNDFSALEGNLQKRICEWYLVPFKNYLCSSEFTLSEELSKVFNEISKEDQ
NIAILKTQSLTQTCTLSCENIPEAIAFNFKNALWKIIAGIVSSEDGDLKRVLHSSYRNLL
LSSKYPANQIAQQILFPALYCPDLSVYAAGNLGVHFCLNDGNYQLNQVKDNITPIKRKIR
CFICKPAATDRGCEIVSTQSTTVSGRCELFAQNDGLAARYSVTTEFDLPEADIARLFASK
DPESQRMIASLLPVLFKHKGAVLCENEDLVQAWSDLIMCPTIEVSMSFTKTLQVIMESLK
ESPLATKQKEKIIQTCLEKLLKAVQQCLQKSDYSYQSAVLQMVVSFATGQGMTEERLLVC
IRMMLFFLMSRESELTREAALAVGDMCGQHGVSPRDMLNWYRHDIVKLMVAIGAVNYILH
ELPLHKSLFHRPACENLLQEIANMIRKDKIVVLSASFLTIYPYLFMNESTAITNQCIDYI
MTHTGNTLVHLLHSDIKKTVSEILIFYHVNPECVLHAFCSLLAKDDSQEITTSQMAEYIS
NRFLGVLTSFEALLINPETEKTLKRETILSLGEIIRLLGGHLIAPFRFKIIALLKTTLAI
EELNLKDACIKVWRIFICTVDVQQLGPLLGTIFVSLEQFIDQYPEDINFIFEYLVVQNNA
LLSQYIKDLFFLEETKVDRQIKKIVSAQTKSVRSREQFLERFNALITHINHENLSVRVYG
LKYLKELFSYHREQLNEALIGHSILPEVPNLLNNLMKSCSDIDTNYRLRSAECIGELGAL
APSYLPPKYAPQERFALNIHSDSFAIMALAELCRAYQFKKETKFVDNFSLAIQEILNDQG
VSPKTGKKIEVWEAIPERLRPIMEPLLTSSYTGLIRTAAVECHPIFGSVKGQTCHEWSYL
WASQLIEKLDKKDSQNLLGSFRPSIRCDFSTMTMFLPYILLHALQGSSEDKRKKITEELQ
YVFDAVMNNNNPEAQSDNPEQQDYYVRSVRTMQFVAKERKAQEEDVASDMSFECAKLAFR
LLDFLEKWKRQWRKVHTLNDASKSDYINVDNFLKQFNHELMANINYTCKEYARSLMYLET
FIEENPSQLQNHLSMLAHIFTHLNDPDSVEGVMCLKTAEPTLPEQILLHNATGRLHQTAA
CYERMLQVGEVKPTDIHNIVEVYLRLDQPKTALLLSESLLNQFSESNVDAMLQEIKAEPL
YKLGRFEELEELLESPQIQQSDSWGVICGSMLVSYRKNDHALFVEKLEQARLAVLRILHS
SDLSISAYEKGYEQVLKLHMIAEFEKCEQLVDNMRSNGLTRCVTEIKQLIENFEARLQLL
QPNAATVEPIISLRRILLNETKSLLNGFAPDISKKEINETIDNHIGELWMKSTELASRAK
LYEQAHLYILHAESYKPKGLFIKKAKLLWEKRDTANVFNILHRGLAEILEKSNLTDPKLL
PKEDRLIYAEGKLLIAIYNADASNVSASVNTRCFKDAVQAHQECEVSLVHMAQYLDKLYA
NFSSDDQDSPKGWELLQDVLTYYGKSMMHGSTCIYQSMPRMLSVWFDFSSKTVNNDNFKK
YSSNINKLALRFSENLSPYFFFTAFSQLISRVAHPSVEVYHVLKSIIIKLILNYPQQSLW
MLLSVYKSSYANRVKRCHEIFNDKQLAKTSIQKMISDFNALAERFIELTNKDIKTPRDVA
VTVSSLVKTLPKLFSDEKLSKIMMPIQKCMQLVLDKSSATFAPYPMNEVYIHGIREEVTV
MQSLQKPRRITLIGSDGRDYMMMMKPKDDLRKDFRLMEFNAVVKQYLHQDPEAKHRRLKI
RTYAVLPLNEECGIIEWVENVSTLRSIIYTYYKQRGVGMHARELREYNFKRQDSLQKKRE
AFDNVLLARHPPVFGEWFRDRFSNPHNWFQARSSYIRTTAVISIVGYILGLGDRHGENIM
LDATNGDTVHVDFNCLFNKGETFEIPEMVPFRLTHNMVKAMGPLGAEGLFRKCCEITLRV
LQNQTPTLMSVLKPFVYDPLVSWSKITKHDGTTERTDPQAMNNVKHIEERLKGYVRTHGK
ICHLPISIEGQVNHLISEATNKDNLAQMFIGWTAYM
NT seq 7671 nt   +upstreamnt  +downstreamnt
atggaagtggatgatgtggcgacgggtggtctttcacccaaggagcagaaaaacaagtcg
gaccaaatgtgggaaacgcttacgacgaccttcgcggaaaatgtccgcaacagaagttcg
cacctggagcagattctgtgcatgatcaaggacaatctcacgtacgacgatccggggctg
tttccgtcctacttgatccaccaggacgacgagcgggaacaggtcaaggcgcacaacttt
tggctgctcaatcagctgattcagatatcggcgatgccggattatttcaacattaagaaa
agtaacaccgatctgcaacagacgatcctcgcggccagctacctgaaacagctgtggttc
ttctacgaagccggcagcaagtatctggagatgctcgagcagctcaaccagatcggtccg
gcggattcggaagtgaacgtccagcttaaaacattccacatgccagacagtgtcttccgc
aggattgagtgttcctgcgtgatcgaaccgattgtcgtaccggacgtgcctacgaagata
aagctgatcgagaacagtctgcacatcctaagccagttggtcagtctggaggacgagcag
gcgaatcgaccgtttcgggagcgatgcgcgagctctgttttgaacacgctaacccatggg
tcgctgaacgaaaagtctctctgtttactgttctttgtcaagtatttcaaaaaagtagct
gaatttactccagatctcgaacgattagtcctagaagtcctaattgtcgtcgatgtcacc
ctcgaacgttcggaccgatggcttcgtagcgaaataatcaaacccaaagcgctggaaaag
ttcaaatctacgctgatgagcttctacgctcgcgtcaacggaatatcgttcaacaattcc
tgcaccgagaatcgtaaaaagatggtttcctgctcgatccggattgtcaaaacgctgctc
acgacaaagaaagacaccgggggatcgatactggatctgcttgagcagatcaaacgattt
ctccggattcttctgaaccatgacgagtcactcgcggttgaagatgaacttagcgatgtt
ctgcagattgcgcgcaagtttcccgaacttttaaacattctggaagttccaatcaccaac
gagctgatcgcgtccgacgatagcaacgaaaccgacgtccgccagctgagtcacatctgg
aagaatgtgtacgagatttcggaggaccaaaagttgaccgattcccagaaggttgtcatc
aaacagaaaacaattcggatcgccttcaacgtgaatcacaacatatcgctctggatgcag
aagcagattccgacgccggctaacaagctgtcttttttcggaggatgtttggccgacctt
ctgcagcagctgtttgagaacgtccaaaagtcaccggtctcaattgaagccgttctagcc
gtgctcgacatttgcttcgatgttgcgtatttgaacgatttttctgcgcttgaaggcaac
ctgcagaagcgcatttgcgagtggtatctggttccattcaaaaactatctgtgctcgtcg
gagttcactttgagtgaggaattgagcaaagtattcaacgagatctcgaaggaagatcaa
aacattgccattttgaagacccaatcgctgactcaaacgtgcactttaagctgtgaaaac
attccagaagcaatagctttcaatttcaagaacgcactgtggaagatcatagccgggatc
gtctcatcagaagacggcgatctcaaacgggtgctgcactcatcctaccggaatctccta
ctctcttccaaatacccggcaaaccaaatcgcccaacaaatcctctttccagctctctac
tgtcccgatctttccgtctacgcagcgggcaaccttggcgttcacttctgcttgaacgac
ggcaactaccagctgaaccaggtaaaagacaacatcactccgatcaagcgaaagatccgc
tgtttcatctgcaaacccgcagctaccgatcgcggctgcgagatcgtcagcacccagtcg
accaccgtctcaggacgttgcgaactgtttgcgcaaaatgacggcctcgctgcacggtac
tcagtgaccacggagttcgacctgccggaggcggatattgcccgactcttcgcgtcgaaa
gatcccgaaagccagcgaatgattgcaagtttgctgccggtgctgttcaagcacaagggc
gcggtgttatgcgaaaacgaagatctggttcaggcctggagcgatctgatcatgtgtccg
accattgaagttagcatgtcattcacaaagacgctgcaagtgattatggaatcgttgaag
gaatctccattggccacaaagcaaaaggagaaaatcatccaaacctgcttggaaaagctg
ctcaaagccgtccaacaatgtctccaaaagtccgactacagctatcaatcagccgtcctg
caaatggtcgttagtttcgccaccggccagggaatgaccgaggaacgccttctagtctgc
atccggatgatgctcttcttcctaatgtctcgcgagtccgaactcacccgggaggcagcc
ctcgctgtcggggacatgtgtggccagcacggagtctcgccgcgggacatgctcaactgg
tacagacacgacatcgtgaagctgatggttgcgattggtgccgtgaactacatcctgcac
gagcttccgctgcacaagtcgctgtttcatcgaccggcctgcgagaatcttcttcaggag
atcgccaacatgatccgcaaggacaagatcgtcgtcctgtccgcctcattcctcactatt
tatccgtacctgtttatgaacgagtcgaccgcaatcaccaaccagtgcatcgattacatt
atgacccacacgggcaatacgttggtccacctgctgcattcggatatcaagaaaaccgtt
tcggaaatcctgatattctaccacgttaacccagagtgtgtgctgcacgcattctgcagc
ttgctggccaaagatgactcgcaggaaatcaccacctcacagatggcggagtacatctca
aaccggttcttgggagtgctgacttcgttcgaagcgctacttatcaacccggaaacggaa
aagacacttaaacgcgagacgatcctcagtctgggtgagatcatccgactgctcggtggt
catctgatcgccccatttcggttcaagatcatcgcgttgttgaagaccacgctggcgatc
gaggagctgaacctgaaggacgcttgtatcaaggtttggcgcattttcatctgcacggtt
gacgtgcagcagctgggtcctctgctcggaacgatctttgtttcgctggaacagttcatc
gaccagtatccggaggatatcaactttatttttgaatacctggtcgtgcagaacaacgcg
ctgctaagtcagtacataaaggacttgttcttcctggaggagaccaaggtcgatcgacag
atcaagaagattgtctccgctcaaaccaagagcgttcgcagccgggaacagttcttggaa
aggttcaacgcactgatcacgcacatcaatcacgaaaatctgtcggttcgtgtgtacgga
ctaaagtatctgaaagagttgttttcctaccatcgtgaacagctgaacgaagccctcata
ggtcactcgatcctcccggaagtcccgaacctgctgaacaatctcatgaagagctgcagc
gacattgacacaaactatcgcctaaggtcggccgagtgtatcggagagttgggtgccctt
gctccgagctaccttccacccaaatacgccccgcaggaacgtttcgcgctcaacattcac
tcggactcgttcgcgatcatggcattggccgagctttgccgggcgtatcagttcaagaag
gaaaccaagtttgtggacaacttttcgctcgccattcaggagattctgaacgatcaaggc
gtctcgccaaagaccggcaaaaagatcgaggtttgggaggcgatcccggaaaggctgcga
ccgatcatggaacctctgcttacctcctcctacactggattgatccggacggccgcggtt
gagtgtcatccgattttcggcagcgtcaaaggacaaacctgccacgagtggtcttacctg
tgggcatcgcagctgatcgagaaattggataagaaagactcgcagaatctgctggggtcg
ttccgaccgagcatacgttgcgacttcagcacgatgaccatgttcctgccgtacattctg
ctgcacgcgctgcagggcagttccgaagataagcggaagaagatcaccgaagagttgcag
tacgtgttcgacgcagttatgaacaacaacaacccggaagcgcagtcggacaatccggaa
caacaagattactacgtgcgatccgttcgaacgatgcagtttgtggcgaaagaacggaag
gcacaggaagaggacgtcgcgtccgacatgtcatttgagtgtgccaagctggcattccga
ctgttggacttcctggagaagtggaaacgccagtggcggaaggtccacacgttgaacgat
gcttccaagtcggattacatcaacgtggataacttcctcaagcagttcaaccacgagctg
atggccaacatcaactacacgtgcaaggagtacgcgcgatcgctgatgtatttggagacg
ttcatcgaagagaacccgtcgcagctgcaaaatcacctgtcaatgctcgctcacattttt
acccatctcaacgatcccgactccgtcgaaggtgtcatgtgcctgaagacagcggaaccg
acgctgccggagcagatcctgctgcacaacgccaccggaaggttacatcagacggcggca
tgttacgagcggatgcttcaggttggcgaagtgaagccgactgacattcacaacattgtc
gaggtttatctgaggttggatcaaccgaaaacggcgttgcttctttcggagagtttgctg
aatcagtttagcgagagcaatgtggacgccatgctgcaggagatcaaggccgagccgctg
tacaagttggggagatttgaagagttggaagagctgctcgagtcgcctcagattcagcaa
agcgacagttggggtgtaatttgtggttcgatgctggtcagctataggaagaacgatcat
gctcttttcgtggagaaactcgagcaagctaggctggccgtgctgcggatcttgcatagc
tccgacctttcgatcagtgcgtacgaaaagggttacgaacaggtcttgaagctgcacatg
atcgcggaatttgaaaagtgcgaacaactggtggacaacatgcgatcgaatggattaacc
cgctgcgtaaccgagatcaagcagctgatcgagaactttgaagcgcgactacagctgctt
caacccaacgccgcgaccgttgaaccgatcatcagtcttcggcggatattactcaacgaa
accaaatcactgctcaacggtttcgcaccggatatcagcaagaaggaaatcaacgaaacg
atcgacaatcacatcggcgaactgtggatgaagagtacggagttggcctcgagagcaaaa
ctgtacgaacaggcccacttgtacattctgcacgcggaaagttacaaaccaaaaggactg
tttatcaaaaaggcaaaactgctgtgggagaaacgcgacaccgcgaacgtgttcaacatt
ttgcatcgtggcctggcggagattctggaaaagtcgaacctaaccgacccgaagctgctg
ccgaaggaagatcgcctgatctacgccgaaggcaaactcttgatcgccatctacaacgcc
gacgcgtcgaacgtttcggccagtgtcaacacgcgatgcttcaaggatgcggtccaagcc
catcaagaatgcgaggtcagcttggttcacatggcgcagtatctggacaagttgtacgct
aactttagcagcgatgaccaggactcgccgaaaggttgggaactgctgcaggacgtgttg
acctactacggaaagtcgatgatgcacggatcgacctgcatctaccaatcgatgccacga
atgctcagtgtttggttcgatttttcatccaaaaccgtcaacaacgacaactttaagaaa
tattcctccaacataaacaaactggcgctccggttcagtgaaaacctttcgccgtacttc
ttcttcaccgccttttcccaactaatcagccgcgtagctcacccgtccgttgaagtgtac
cacgtcctaaagtccatcatcatcaagctcatcctaaactacccccagcaatcgctctgg
atgctgctgagcgtgtacaaaagttcgtacgcaaatcgcgtcaagcgatgccacgagata
ttcaacgacaagcagctcgccaagacctccatccagaagatgatcagcgattttaacgcg
ctggcggagcgattcatcgaactcaccaacaaagacatcaagacgccacgggacgtcgcg
gtgacggtttcgtcgctggtaaaaaccctgccgaagctttttagcgatgaaaagctgtct
aagatcatgatgcccatccaaaagtgtatgcagctggtgctggacaagagctcggcgacg
tttgcgccgtacccgatgaacgaggtgtacatccacgggatacgggaagaggttaccgtt
atgcaatctctgcaaaaaccgcgcagaatcacgctgattggaagtgacggtcgcgattac
atgatgatgatgaaacccaaagacgacctgcgcaaggactttcggctgatggagttcaac
gccgtggtgaaacaatacctgcaccaagatccggaagccaagcatcggcggctgaaaatt
cgtacctacgcggtgcttccgctgaacgaagagtgcggcattatcgagtgggtggagaac
gtgagtacgttgcgcagtatcatctatacgtactacaagcaacgtggcgtcggaatgcac
gcaagggaactccgcgagtacaactttaagcgacaagattcgctacagaaaaagagggag
gcgtttgacaacgtcctgttggctcgccatccgccggtgtttggcgaatggttccgcgat
cggttctcaaacccgcacaactggttccaagcgcgtagttcgtacatccgtactaccgct
gtgatctccatcgtcggctacatcctggggctgggtgatcgtcacggtgaaaatattatg
ctggacgccacaaacggagacaccgtccacgtggactttaactgtctcttcaacaagggc
gaaacgtttgaaattccagagatggtgccattccgcctcacgcacaacatggtcaaagcg
atggggccgctcggtgccgaaggccttttccgcaagtgttgcgaaattacgctgcgggtg
ctgcagaaccaaacgcccacgctgatgtccgtgctgaagccgttcgtgtacgatccgttg
gtgtcgtggagtaagatcaccaaacacgacggaacgaccgagcggaccgatccgcaagcg
atgaacaacgtcaagcacatcgaggagcggctgaagggttacgtgagaacgcacggcaag
atttgtcacttgccgatttcgatcgagggccaggttaatcacttgataagcgaagctaca
aacaaggacaacctggcgcaaatgttcatcggctggactgcctatatgtaa

DBGET integrated database retrieval system