KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002767
Entry
CpipJ_CPIJ002767  CDS       T01079                                 
Name
(GenBank) single-strand selective monofunctional uracil DNA glycosylase
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ002767
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ002767
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     CpipJ_CPIJ002767
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CpipJ_CPIJ002767
 Prokaryotic type
     CpipJ_CPIJ002767
SSDB
Motif
Pfam: UDG DUF4918
Other DBs
NCBI-ProteinID: EDS36690
VectorBase: CPIJ002767
UniProt: B0W6L6
AA seq 325 aa
MLRKKLKLSDQPEPEPTTAGFDYAPMEFALRPQSLLPITSPHFEPKPQFAPQPQYQPELP
AIPSAVPLYYLPPVVPALPLWHRIYQLELQLCEALKQIPLPAEVAATYDPIQYAAELHLA
YMQRFLDRPKAVLFLGMNPGPWGMCQTGVPFGHVPSVRDWMQLRGQVYKPIGELEARPVQ
GLACTRGEQSGQRWWGLYEQLCGTPENFFRNCFVWNICPLAFFHSSGRNITPAELKGPAK
TRIQQVCNEFLKTALDLFNPVIIVSVGRYTEDRVKALVKQNLLDPNRVQLSCMPHPSPRS
LNNTNWLEKARQWLVDHGVMPYLQS
NT seq 978 nt   +upstreamnt  +downstreamnt
atgttgcgcaaaaagttgaaactgtccgaccagccggaaccggaacctaccaccgccggc
ttcgattacgctccgatggagtttgccctccgtccccagtcattactgcccataacttca
cctcatttcgagcccaagccacaattcgcaccacaaccacaataccaaccggaacttccg
gccattccgtcggctgtaccgctgtactacctacctccggtcgttccggcccttccgctg
tggcatcgcatctaccagctcgaactgcagctgtgcgaagcgctgaagcagattccactg
ccggcggaggtggccgccacgtacgatcccattcagtacgccgccgagctgcacctggcg
tacatgcagcgctttctggaccgtccgaaggcggtgctgttcctcggcatgaacccgggc
ccgtggggcatgtgccagaccggggttcccttcggacacgttccgtccgttcgggattgg
atgcaactgcgtggccaggtgtacaagccgattggggagttggaggcgcgtccggtgcag
ggattggcgtgcacccggggcgagcagagtggccaacgctggtggggattgtatgagcag
ctgtgtggtacaccggaaaacttcttccgaaactgcttcgtgtggaacatttgtccgttg
gcgttcttccactcgagcggacgaaacattacgccggcggagctgaagggcccggcaaaa
actcgcattcagcaggtctgcaacgagttcctgaagacggcgttggatctgtttaacccg
gtgatcatcgtgtccgttggtcggtacaccgaggatcgcgtgaaagccctggtcaagcag
aacctgctcgatccgaaccgggtgcagctcagctgcatgccccatccgagtccgcgaagc
ctcaacaacacaaactggttggagaaggctcgccagtggctcgttgaccacggggttatg
ccgtacctgcagtcttag

DBGET integrated database retrieval system