KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003295
Entry
CpipJ_CPIJ003295  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10803  DNA-repair protein XRCC1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ003295
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003295
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     CpipJ_CPIJ003295
SSDB
Motif
Pfam: XRCC1_N PTCB-BRCT BRCT
Other DBs
NCBI-ProteinID: EDS39037
VectorBase: CPIJ003295
UniProt: B0W8I7
AA seq 500 aa
MRTFTIFKVMVRPFVLPFNGHFVGQQEAGPTPRSHTLGLAAVRAEEPAATPNPSRIIVFA
LARVAINTKEHARTGRSSSNDAGRFCSHRLIESRNLTNSGRVRYFTAKELVKPEAKEWWN
LVKVICTQPFNSRVQYGVAFVMLHLVGGKKKDKPLVPAAFQKQIQEKFQKKEPPKMLQLG
MFKLREEFPGKLGGVICALESVAIRCGLATRRELTHNDSGQGSDVYGGTIRDASTPAGIR
NTLASPQPAKMMTKITPKPKPRLFDDNGEKEKASEPKPGRPANIFFDEPETSSEKKNSAR
RDRTSDIKKPKLDKDQDREEDEERKRKPVTYKSLNNLFEKVVLVISGIQNPERANLRNQA
LAMGAKYKSDWDSSCTYEFDLRLQKYPQVQPGLRLRTKLINDEKNADRITSEFIEPTASI
PLDRLFPTVSSSIIFDPDEQLSKCTTNEFKQCSIRQSSLPWTRMFPALRNTSSFNPAICF
AAFVSRLAPSATAVLRNSNS
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgcgaacgttcacgatctttaaggttatggttagaccttttgtgttgccgtttaacggc
cattttgtcggtcagcaggaagctggtccgacaccacgatcgcacactctcggcctagca
gcagtaagagcggaggagccagctgctacgcctaacccgtcaaggataatcgttttcgct
ctggccagggtggccatcaacaccaaggagcacgctcggaccggaagaagcagctcaaat
gatgctggacgcttctgtagccaccgtctgatcgagagccgcaacttgaccaacagcggc
cgggtgcgatacttcacggcgaaggaactggtcaagccggaggccaaggagtggtggaat
ttagtgaaggttatttgtacgcagccgttcaatagtcgggttcagtacggggttgctttt
gtgatgctgcacttggttgggggcaagaagaaggacaaaccgctggttccggccgcgttt
cagaagcagattcaggagaagtttcagaagaaggagcctccgaagatgcttcaacttggg
atgtttaagctccgggaggaatttcccgggaagctcggcggggttatttgcgcgctggaa
agcgtcgcgatccggtgcggactcgcaactcgtcgcgagttaacccacaacgactccggc
cagggcagcgacgtctatggcggcacgattcgggacgcgtcgacgccggcgggcatccgg
aatacgttggcctctccacaaccagccaaaatgatgaccaaaatcacgccaaagccgaag
ccacgactctttgacgacaatggcgagaaggaaaaagcctcggaaccgaaaccaggacgc
cctgctaacattttctttgacgaaccggaaacttcgtcggagaagaagaactctgcccgt
cgggacagaacatccgacatcaagaagccaaagttggacaaggatcaagatcgggaagaa
gatgaagagcggaagcgaaagccggtgacgtacaagtcattaaacaatttgtttgaaaag
gtggtgctcgtgattagcgggattcaaaatccggaacgggccaacctgcggaatcaggcg
ctggccatgggagccaagtacaagtccgattgggattcaagctgtacctacgaatttgat
ttgcgtcttcaaaaatacccccaagtacaaccaggtctacggctacgaaccaaactcatc
aacgacgagaaaaacgctgacagaatcacgtcggagtttattgagccgactgcttccatc
ccgctggaccggctgtttccgacggtttcttcgtccatcatcttcgacccggacgaacaa
ctctcgaaatgcacaaccaacgagttcaagcagtgctctatccggcagagcagcctaccc
tggactagaatgttcccggcgctgcgaaacacctccagcttcaatcccgccatctgcttt
gccgcattcgtcagcagattggcaccatccgcaacggcagttctaaggaacagcaacagt
taa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011204
Entry
CpipJ_CPIJ011204  CDS       T01079                                 
Name
(GenBank) DNA-repair protein XRCC1
  KO
K10803  DNA-repair protein XRCC1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ011204
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ011204
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     CpipJ_CPIJ011204
SSDB
Motif
Pfam: XRCC1_N PTCB-BRCT BRCT BRCT_2
Other DBs
NCBI-ProteinID: EDS37514
VectorBase: CPIJ011204
UniProt: B0WZK0
AA seq 665 aa
MPTVSLASIESFSSEDPNFPASNLLAKETRRWKCRDAGEKSAFVVFRLDGGAVCITGIDI
GNEHSAFVEVLVGRSGPAVPEFKEILLTSSFMSPIESRNSTNSGRVRCFTAKELVESVAR
ERWDLVKVICTQPFNSRVQYGVAFVTLHSGGGERKDKPLVPAAFQRQIQEEGLKKEPSRV
VQLGRFKLREESPDSDEGSEGLFARWKAARSGADTQPVASKPATTPARAATSTAAAIRDA
STPAAIRNSLASPQAAKMTTKITPKPKPRLFDDDEGKEEASVKPRDRNRDALLYDKEDDK
PNEKLERKLAEDRARKQREKDAKEERERRERSLSEKKKEKLHDTSATKFKNFLFDEPETS
SEKKSSSEKDRRKDEEAKRSRDREKKSSPERKKRPTESSSGSRDRTSEIKKPKLDKDREE
DEERTRKPVTYKPFNKLLEKVVLVISGIQNPDRANLRNQALAMGAKYKSDWDSSCTHLIC
AFKNTPKYNQVHGQGKIVRKGWIERCHALRKRLSWRKFALDSDETERSDSEGEIVDEARR
PKQDPPQRGCSPVKDPSLRKETDEEALAHYDLDDVAIVEDKPPTYELSGSDTEEEIERVK
QKQREQVKDRSEVYDKSTEEEEGRNGGEEKEKQLDFFKRKRFLLDDDVGAVDVIKLERYV
ELYKG
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgccaaccgtgtcgctcgcttccatcgagagtttcagcagcgaagatccgaacttccct
gcctcaaacctgctcgccaaggaaacgcgccgctggaagtgccgcgacgcgggtgaaaag
agcgccttcgtcgtgttccggctggacggcggtgccgtttgcatcaccggaatcgacatc
ggcaacgagcactcggcgttcgtggaggtgctggtggggcggagcggtcctgcggtgccg
gagtttaaggagattttgctcacctcgtcgtttatgagtccgatcgagagccgcaactcc
acgaacagtgggcgggtgcgatgcttcacggcgaaggaactggtggagtcggtggccagg
gagcggtgggatttggtgaaggttatttgtacgcagccgttcaacagtcgggttcagtac
ggggtggcttttgtgacgctgcactcgggtgggggcgagcggaaggacaaaccgctggtt
ccggccgcgtttcagcggcagattcaggaggagggtttgaagaaggaaccttcgagggtg
gttcagctggggaggtttaagctgcgggaggaatctcccgattcggacgagggaagcgag
gggttgtttgcgcgctggaaagcggcgcgatccggtgcggatacgcaacccgtcgcgagt
aaacccgcaacgaccccggccagggcagcgacgtctacggcggcagcgattcgggacgcg
tcgacgccggcggctattcggaactcgttggcctccccacaagcagctaaaatgacgacc
aaaatcacgccaaagccgaagccacgactctttgacgacgatgaggggaaggaagaagcg
tcggtcaagcctcgagaccggaaccgggacgccctgctgtacgacaaggaagacgacaag
ccgaacgaaaagctggagcgcaagctggccgaagatcgtgcccggaagcagcgcgaaaag
gacgccaaggaggagcgtgagagacgagagcggtctttatcggagaagaagaaggaaaag
ctacacgacacgtcggcgaccaagtttaagaactttctttttgacgaaccggaaacttcg
tcggaaaagaagagctcctccgagaaggatcgtcgcaaggacgaggaagcgaagcggagt
cgggatcgggagaaaaagtcgtcaccggagcggaagaagcgaccgacggagtcgtcctcc
ggcagtcgggaccggacatccgaaatcaagaagccaaaactggacaaggatcgggaagag
gacgaagagcggacgcgaaagccggtgacgtacaagccattcaacaagttgcttgaaaag
gtggtgctcgtgattagcgggattcagaatccggatcgggccaacctgcggaaccaggcg
ctggccatgggagccaagtacaagtccgattgggactcaagctgtacgcatttgatttgc
gccttcaaaaacactcccaagtacaaccaggtccacggccagggcaagatcgtccgcaag
ggctggatcgaacggtgccacgccctacgcaaacgcctctcgtggcgcaagttcgccctc
gattcggacgaaacggaacgctcggactccgaaggggaaatcgtggacgaagcgcgccgg
ccaaagcaggatccgccccaacgtggttgttcgccggttaaggatccctctctccgcaag
gaaacggacgaggaagcactggcgcactacgatctggacgatgtggcgatcgtggaggac
aagccacccacgtacgaactgtccgggtcggacacggaggaggagatcgagcgggtcaag
cagaaacagcgcgagcaggtcaaggataggagtgaggtgtacgataagagtaccgaggag
gaagaggggaggaatggtggtgaggagaaggagaagcagctggactttttcaagcggaaa
cggttcctgctggacgacgacgtgggtgccgtggatgtgatcaagctggagcggtacgtg
gagctgtacaaagggtag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012852
Entry
CpipJ_CPIJ012852  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10803  DNA-repair protein XRCC1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ012852
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ012852
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     CpipJ_CPIJ012852
SSDB
Motif
Pfam: XRCC1_N PTCB-BRCT BRCT BRCT_2
Other DBs
NCBI-ProteinID: EDS38077
VectorBase: CPIJ012852
UniProt: B0X0B6
AA seq 615 aa
MPTVSLASIESFSSEDPNFPASNLLAKETRRWKCRDAGEKSAFVVFRLDGGAVCITGIDI
GNEHSAFVEVLVGRSGPAVPEFKEILLTSSFMSPIESRNSTNSGRVRCFTAKELVESVAR
ERWDLVKVICTQPFNSRVQYGVAFVTLHSGGGERKDKPLVPAAVVQLGRFKLREESPDSD
EGSEGLFARWKAARSGADSQPVATTSTAAAIRDASTPAAIRNSLASPQAAKMTTKITPKP
KPRLFDDDEGKEEASVKPRDRNRDALLYDKEDDKPNEKLERKLAEDRARKQREKDAKEER
EKRERSLSEKKKEKLHDTSATKFKNFLFDEPETSSEKKSSSEKDRRKDEEAKRSRDREKK
SSPERKKRPTESSSGSRDRTSEIKKPKLDKDREEDEERTRKPVTYKPFNKLLEKVVLVIS
GIQNPDRANLRNQALAMGAKYKSDWDSSCTHLICAFKNTPKYNQVHGQGKIVRKGWIERC
HALRKRLSWRKFALDSDDAERSDSEGEIVDEARRPKQDPPQRGCSPVKDPSPRKETDEEA
LAHYDLDDVAIVEDKPPTYELSGSDTEEEIERVKQNSASRSRIGRVIKKRESDKKERERD
KKRVIKKREKEIKRE
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgccaaccgtgtcgctcgcttccatcgagagtttcagcagcgaagatccgaacttccct
gcctcaaacctgctcgccaaggaaacgcgccgctggaagtgccgcgacgcgggtgagaag
agcgccttcgtcgtgttccggctggacggcggcgccgtttgcatcaccggaatcgacatc
ggcaacgagcactcggcgttcgtggaggtgctggtggggcggagcggtcctgcggtgccg
gagtttaaggagattttgctcacctcgtcgtttatgagtccgatcgagagccgcaactcc
acgaacagtggacgggtgcgatgcttcacggcgaaggaactggtggagtcggtggccagg
gagcggtgggatttggtgaaggttatttgtacgcagccgttcaacagtcgggttcagtac
ggggtggcttttgtgacgctgcactcgggtgggggcgagcggaaggacaaaccgctggtt
ccggccgcggtggttcagctggggaggtttaagctgcgggaggaatctcccgattcggac
gagggaagcgaggggttgtttgcgcgctggaaagcggcgcgatccggtgcggattcgcaa
cccgtcgcgacgacgtctacggcggcagccattcgggacgcgtcgacgccggcggctatt
cggaactcgttggcctccccacaagcagctaaaatgacgaccaaaatcacgccaaagccg
aagccacgactctttgacgacgatgaggggaaggaagaagcgtcggtcaagcctcgagac
cggaaccgggacgccctgctgtacgacaaggaagacgacaagccgaacgaaaagctggag
cgcaagctggccgaagatcgtgcccggaagcagcgcgaaaaggacgccaaggaggagcgt
gagaaacgagagcggtctttatcggagaagaagaaggaaaagctacacgacacgtcggcg
accaagtttaagaactttctttttgacgaaccggaaacttcgtcggaaaagaagagctcc
tccgagaaggatcgtcgcaaggacgaggaagcgaagcggagtcgggatcgggagaaaaag
tcgtcaccggagcggaagaagcgaccgacggagtcgtcctccggcagtcgggaccggaca
tccgaaatcaagaagccaaaactggacaaggatcgggaagaggacgaagagcggacgcga
aagccggtgacgtacaagccattcaacaagttgcttgaaaaggtggtgctcgtgattagc
gggattcagaatccggatcgggccaacctgcggaaccaggcgctggccatgggagccaag
tacaagtccgattgggactcaagctgtacgcatttgatttgcgccttcaaaaacaccccc
aagtacaaccaggtccacggccagggcaagatcgtccgcaagggctggatcgaacggtgc
cacgccctacgcaaacgcctctcgtggcgcaagttcgccctcgattcggacgacgcggag
cgctcggactccgaaggggaaatcgtagacgaagcgcgccggccaaagcaggatccgccc
caacgtggttgttcgccggttaaggatccctctccccgcaaggaaacggacgaggaagca
ctggcgcactacgatctggacgatgtggcgatcgtggaggacaagccacccacgtacgaa
ctgtccgggtcggacacggaggaggagatcgagcgggtcaagcagaacagcgcgagcagg
tcaaggataggaagagtgataaaaaagagagagagtgataaaaaagagagagaaagagat
aaaaagagagtgataaaaaagagagagaaagagataaaaagagagtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ020141
Entry
CpipJ_CPIJ020141  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10803  DNA-repair protein XRCC1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ020141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ020141
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     CpipJ_CPIJ020141
SSDB
Motif
Pfam: XRCC1_N PTCB-BRCT BRCT
Other DBs
NCBI-ProteinID: EDS34000
VectorBase: CPIJ020141
UniProt: B0XLF0
AA seq 391 aa
MPPSYELFQGGHSSRELAKIRQKSGKRSSSNDAGRFCSHRLIGSRNLTNSCRVRYFTAKE
LVKPEAKDWWNLVKVICTQPFNSRVQYGVAFVMLHLVGGKKKDKPLVPAAFQKQIQGKVQ
KKEPPKMLQLGMFKLREEFPGSVEGSSAGRSHDSLTTMARRKKPRNRNQDALLYDKPNEK
LEHKLAEDCVRKHREKDAMEEREQRRRPSSRTFSLTNRTSEKKNSARRDRTSDIKKPKLD
KDQDREEDEERKRKPVTYKSLNNLFEKVVLVISGIQNPERANLRNQALAMGAKYKSDWDS
SCTYEFDLRLQKYPQVQPERSDSAGEIVDEARRPELPEMATVKDQPIELSQEKLAVLKSL
LKYVSERNKQRTEAAINDHFEADLDPLEECW
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccaccgagttatgaattattccagggtggccactcaagtcgggaattagcaaaaatc
cgccaaaaatctggaaaaagaagcagctcaaatgatgctggacgcttctgtagccaccgt
ctgatcgggagccgcaacttgaccaacagctgccgggtgcgatacttcacggcgaaggaa
ctggtcaagccggaggccaaggactggtggaatttagtgaaggttatttgtacgcagccg
ttcaatagtcgggttcagtacggggttgcttttgtgatgctgcacttggttgggggcaag
aagaaggacaaaccgctggttccggccgcgtttcagaagcagattcaggggaaggttcag
aagaaggagcctccgaagatgcttcaacttgggatgtttaagctccgggaggaatttccc
ggttcggtcgagggaagctcggctggccgaagccacgactctttgacgacaatggcgaga
aggaagaagcctcggaaccgcaaccaggacgccctgctgtacgacaagccaaacgaaaag
ctggagcacaagctggccgaagattgtgtccggaagcaccgtgaaaaggacgccatggag
gaacgcgagcaacgtcggcgaccaagttcaagaacattttctttgacgaaccggacgtcg
gagaagaagaactctgcccgtcgggacagaacatccgacatcaagaagccaaagttggac
aaggatcaagatcgggaagaagatgaagagcggaagcgaaagccggtgacgtacaagtca
ttaaacaatttgtttgaaaaagtggtgctcgtgattagcggaattcaaaatccggaacgg
gccaacctacggaatcaggcgctggccatgggagccaagtacaagtccgattgggattca
agctgtacctacgaatttgatttgcgtcttcaaaaatacccccaagtacaaccagagcgc
tccgactcggcgggtgaaatcgtggacgaagcgcgccggccagaattgccggaaatggca
acggtcaaagatcagccgattgaactttctcaggaaaagcttgccgttttgaagagcttg
ctcaaatacgtgagtgagcggaacaagcagcggacggaagcggcaattaatgaccatttc
gaggcagacctagatccgttggaagagtgttggtag

DBGET integrated database retrieval system