KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003345
Entry
CpipJ_CPIJ003345  CDS       T01079                                 
Name
(GenBank) DNA polymerase eta
  KO
K03509  DNA polymerase eta [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ003345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003345
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ003345
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    CpipJ_CPIJ003345
SSDB
Motif
Pfam: IMS zf_UBZ IMS_C PRP21_like_P IMS_HHH
Other DBs
NCBI-ProteinID: EDS39087
VectorBase: CPIJ003345
UniProt: B0W8N7
AA seq 820 aa
MSTKQLINVNNKYDRVVVLVDMDCFYCQVEEKLNPEIKGQPIAVVQYNPWQGGGIIAVNY
PARARGVTRHMRGDEARQHCPEIVLPQVPQRGGKADISKYRDAGKEVAAVLQTFTPLLER
ASVDEAYMDITERVLARLHDMNVGKFHLQPETLDNTFAVGYESVGQYVQKISCDLDGRSS
SQELESEEDRVAYKKSDIKLLIGASIVNEIRAAVKEKTGYECSAGIAHNKILAKLTAGFN
KPNKQTVLPLKSISKLYQTLQIKKVKGLGGKLGEQVCELLKIEFMSQLTQFSEKQLQAHF
DERMGSWMYLMARGIDLEAVTPKFNSKSIGCCKRFPGKNAITGLATLQHWLGELANEIQD
RLEKDLDENNRTARQMTVSYAQQIGDNDVSSTRSVPLVCYEAERIAKDALEAIRRNTEVF
LKQGSNGALNNAVKFLGISAGKFENNATGKKSALKEMFSNIASKAPNPGETSKDAPTSYN
IASNAPNSGESSKDAPKSETTAMKATKRDISSFFNAKGGEKDGSSVADETSASVDVAVKT
EDIPLPEASVAETVEEDNYSNKTLPLDEAQENIPSPKPSPKAEPLRSDSKEIEVEETSEP
AVISTTVPSNDDCKPSTSGLDYRSTYAEFQCLEQQQPVPTISVTTKPCPECGKNVPEHTL
QSHLDFHVALRISQQQREEFRNELKQKLSSPAATAPKPIKPAANQTPKAKSSKAKIDKYL
TSAAQNRTASAVSEDATSVARCDECGKMVALDAVQEHSDFHAAKKLQLELNRQEMRTVTT
NGFQTKPATTGGGAKRKRPPGGDKVQPVKINNLSSYFTKM
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtcaactaaacagttaatcaacgttaacaataaatatgacagagttgtggttttggtg
gacatggattgcttctactgccaggtcgaagagaagctcaatccagaaatcaaagggcaa
ccaattgccgtagttcagtacaatccgtggcagggtggagggataatcgccgtcaactat
ccggcgagggccaggggcgttacgcggcacatgcgcggtgacgaggcgcgccagcactgt
ccggagattgtgcttccccaggttccgcagcggggcggtaaggccgacatttccaagtac
cgcgatgcggggaaagaggttgcggccgtcctgcagaccttcactccccttttggagcga
gcgagcgtcgatgaggcctacatggacataacggaacgagtgctggcaagactgcacgat
atgaacgtgggcaagtttcatctgcagccggagacgttggacaatactttcgcggtgggc
tatgaaagcgtcggtcagtacgttcagaaaatttcttgtgatttggacggacgtagcagc
tcgcaagagctggaaagcgaagaggatcgggtcgcatacaagaagagtgacatcaagctg
ttgattggagcttccatcgtcaacgagatccgcgcagcggtgaaggagaaaacgggttac
gagtgctcggcaggcatcgcgcacaacaaaattctcgccaagctcacggcagggtttaac
aagcccaacaagcaaaccgtgcttccgctgaaaagcatctcgaaattgtaccaaacgtta
cagatcaaaaaggtcaaaggtttgggtggaaaactgggcgaacaggtgtgcgagctgctg
aagatagagttcatgtcccagttgacacagttttcggagaagcagctgcaagctcatttt
gacgagcgcatgggttcgtggatgtatttgatggctcgaggaatcgatttggaagcagtc
acgcccaagttcaactcaaagagcatcggctgttgtaagcgattcccggggaagaacgcc
atcactggactggccaccttgcagcactggctaggggagctggcgaatgagatccaggat
cgtttggagaaggacttggacgaaaataatcgcactgcacgtcagatgaccgtgagctac
gcgcagcagatcggagacaacgacgtttcgagcacgagaagtgtgccgctggtgtgttac
gaagcggaacgcatcgcaaaagatgctttggaagcgattcgacgtaatacggaggtattt
ctgaagcaaggcagcaacggagcgctgaacaatgctgtcaagtttcttgggattagcgca
gggaagtttgagaataacgcgaccggcaagaagagtgcgctgaaggagatgttctccaac
attgcaagcaaggcgccgaatccgggggaaacgtcgaaggatgcgccgacatcatacaac
attgcaagcaatgcgccgaattcgggggaatcgtcgaaggatgcgccgaagtctgaaacg
acggccatgaaggcgaccaaaagggatatttcaagctttttcaacgctaagggaggagaa
aaggatggttcttcagttgcagatgagacctcggcaagtgttgacgtggccgttaagaca
gaggatatcccgctgccggaggcgagtgttgccgaaaccgtagaggaggacaactattca
aacaagaccttgcctttggacgaggctcaggaaaatattccgtcacctaagccgtcgccg
aaagctgagcctctacgaagcgattccaaggaaatcgaggttgaagaaacatccgaacca
gcagtgatttcaacaaccgtgccatcaaacgacgattgcaagccgtcgacttccggtctc
gattaccgctcgacctatgccgagttccagtgtctggaacagcagcagcccgttccgaca
atttccgtaaccaccaaaccgtgcccggagtgcggtaaaaacgttcccgagcacaccctg
caatcccacctggactttcacgtggccctgcgaatcagccaacagcagcgcgaagagttt
cgcaacgagctcaaacaaaagctgtcttcgccagcggcgacggcgccaaaacccatcaaa
cctgccgccaatcaaacgcccaaagccaaatcgagcaaagcaaaaatcgacaaatacctc
acctcagcagcacaaaacagaaccgcgagcgccgtcagcgaggacgcgaccagcgtggcg
cgatgtgacgaatgtggcaagatggttgccctggatgccgtgcaggagcactcggacttt
cacgcggcgaagaagcttcagctcgagctgaaccggcaggagatgcggacggtcacgacg
aacgggttccagacgaagccggccacaactggtggcggagccaagcggaagagaccccct
ggcggggataaggttcagccggtgaagattaacaacttgtcatcgtactttacgaagatg
tag

DBGET integrated database retrieval system