KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003591
Entry
CpipJ_CPIJ003591  CDS       T01079                                 
Name
(GenBank) DNA repair protein xp-c / rad4
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ003591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003591
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      CpipJ_CPIJ003591
SSDB
Motif
Pfam: BHD_3 BHD_1 Rad4 BHD_2 Stc1
Other DBs
NCBI-ProteinID: EDS39772
VectorBase: CPIJ003591
UniProt: B0W975
AA seq 798 aa
MDPAKRSLRDKIFSRLPKAARTEPAVVVEEISNPPPPPIQQPDRDPEPEVDSDGSSSVGD
HLVNLEDIDLDAQFFSQEFRSENVASIEERVPPEVLSSDSDGEGDAEERGRICEMLTQLA
QFNSDAAREVVERNREVAASVDVGMDGEEILKSIHKVEGIEVVEQKEGSDGEWELIKALN
VEETKQKDVEVTITQRKTGKNGRGFYLNKLVNQAVSDCSQEIVQLLNIQQDEVPSEPDFN
YLKSVCDICQKIRRVDEFSNSCRKMFSENISRDEAFELLSITILRFLAIEARLVMYLNVI
SKAMVQEKPKPKPQPKAKSNPSPEPPTQRYTDVALTTSEILKRKPEFAHFSQVPQLDGAD
DAPVQPKRPRLWKLKQSAPARVSVSSGKSKRGTTSKFFNKSSKAKQTKKPVSVQQPSLSL
WIEVYLTAEKCWTPVDILNNQVGLEHVMKRLPDPVVYVFGWSNDGTLQDVSGRYWWKNEM
SARHQRVTEKWLRPVLHRFDRKRKVMRDLVDQLQFRQLRSRAPIPEKLSEFKNHPSYCLK
RDLLKFQAIYPPDAPPLGFFHGEPIYGRECVHTLHSREVWLRHAKTIRLRESPYKVVMSK
LRREPTQLELFGHWQTDEYVPPEPCDGKVPRNAYGNIEIFKECMLPRGAVHLKQPNISRI
CRRLNVDYAPAVVGFGIHAGGNHPVFEGIVICREFEQRVLDEYERDLVEQEQRKREKRER
RIYDNWRKLIKGLLIRSRARTLVSIANSLKERREHQVVRRREFFCTSSLAPFVTPSSLKN
LDTLTSSIGLAITEPCVY
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggaccccgcgaagcgatctcttcgtgacaaaatcttcagcagactgcccaaggcggca
cgcacggaaccagccgtcgtcgttgaggaaatctcgaacccaccaccaccgcctatccaa
caaccagatcgggacccggaaccggaagttgactcggacggctcgagcagcgtcggcgac
cacctggtgaacctcgaggacatcgatctggacgcgcagtttttcagccaggagtttcgg
agcgagaatgttgcgtcgattgaagaaagggtaccgccggaagtgctgtcgagtgattcg
gacggggagggtgatgctgaagagaggggacggatttgcgagatgctcacgcagctggcg
cagtttaatagcgacgctgctcgggaggttgttgagcggaacagggaggtcgcagcttcc
gttgatgtagggatggatggggaggagattttgaagtcgattcataaggttgagggaatt
gaagtggtagaacagaaggaaggttccgatggggaatgggagctaattaaggctttgaat
gttgaggaaacgaaacagaaggatgttgaagtaaccataactcaacggaaaacgggtaaa
aatggaaggggattctacctgaacaagttagttaatcaagcagtatcagattgtagccaa
gaaattgtccaactgcttaacattcagcaagacgaggtaccttctgaaccagatttcaat
tatctgaagtcagtttgtgatatttgccaaaagattagaagagtagacgaattttctaat
agttgtagaaaaatgtttagcgaaaatatctctcgagacgaagcgttcgaactgttgagc
atcacaattctgcgatttctagccatagaagcacgactagtcatgtacttaaacgttata
tccaaagccatggtccaagagaagcctaaaccgaaacctcaaccgaaagccaaaagtaac
ccgtccccagaaccgccaactcaacgctacactgatgtcgctcttacaacctccgagatt
ttgaagcgaaagcccgagtttgctcacttttcacaagttccacaactcgacggagccgat
gacgcgccggtacagccgaaacgacctcgcctgtggaagctgaagcaatctgcacccgca
agagtgtccgtttcaagcggaaagtcgaaacgtgggacgacctccaagttcttcaacaag
tcttcgaaggcaaagcagacgaagaaaccggtatccgttcaacagccaagtctatccctg
tggatcgaagtgtatctcacggcggagaagtgctggactcccgtggacatcctgaacaat
caggttggcttggagcacgtgatgaagcgacttccagatccagtggtctacgtattcggc
tggagcaacgacggcacgttgcaggatgttagcgggcggtattggtggaaaaatgagatg
tccgctcgacatcaacgcgtcaccgaaaagtggctgcgtcccgtgcttcaccgcttcgac
agaaaacgaaaggtcatgcgcgatctcgtggatcagctgcagtttcgacagctgcggtcc
agagcgccgattccggagaagttgtccgagttcaaaaaccacccctcgtactgcctcaaa
cgtgacctgctcaaattccaagccatctacccgccggacgcacccccgctaggcttcttc
cacggcgaacccatctacggccgcgagtgcgtccacacgctgcactcgcgcgaggtttgg
ctgcgccacgccaaaaccatccgcctgcgcgagtccccctacaaggtggtcatgtccaag
ctgcgccgggagcccacccagctcgagctgttcggccactggcagacggatgagtacgtg
ccgccggagccgtgcgacggcaaggttccgcgcaacgcgtacggcaacatcgagatcttc
aaggagtgcatgctgccgcgcggggcggtccatttgaagcagcccaacatctcgcggatc
tgtcgccggttgaacgtggactacgcgcccgccgtggtcggctttgggattcacgccggt
ggaaatcaccccgtgttcgaggggattgtaatctgccgggagtttgagcagcgtgttctg
gacgagtacgagcgcgacctggtggagcaggagcaacggaagcgggaaaagcgcgagcgt
cggatatacgacaattggcgcaaactgatcaaaggactgctgatccgaagcagagcacgg
acgctcgtcagcatcgcaaattcgctcaaggagagacgagaacatcaggttgtacgtcgt
agagagttcttttgtaccagctcgttggcaccattcgtaacgccatcttcgcttaaaaat
ctggataccctaactagctcaatcggccttgccatcacggagccgtgcgtctattaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003592
Entry
CpipJ_CPIJ003592  CDS       T01079                                 
Name
(GenBank) DNA-repair protein complementing XP-C cells
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ003592
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003592
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      CpipJ_CPIJ003592
SSDB
Motif
Pfam: BHD_3 BHD_1 Rad4 BHD_2
Other DBs
NCBI-ProteinID: EDS39773
VectorBase: CPIJ003592
UniProt: B0W976
AA seq 307 aa
MRHATAPISYVFGFDNAGHIKDVTPRYVQHWNTVCRKSRVEQKWLEKALKPFLPEKSDRD
EQENADLNKIDLDKPLPTTIAECKNHPLYVLKRHLLKFEALYPVEVPSLGFVRGEAIYAR
ECVFVLKTREKWYKEGRVVKPFETAYKVVKCWRYDKEKNEWLGNQPCDIFGIWQTDEYDP
PTAENGVVPRNEYGNVELFTPKMLPKKTVHLQLPGLNRVCRRLGIDCAPALTGFEKARMR
MIPVYDGFVVCEEFGDQVTEEWYKEMEEEERREQEKLEKRVYGNWKKLIRGVLVRRKLQN
KYNFDNL
NT seq 924 nt   +upstreamnt  +downstreamnt
atgcgccacgcgaccgcccccatcagctacgtgttcggcttcgacaacgcgggccacatc
aaggacgttacgccgcgctacgtccagcactggaacaccgtttgccgcaagtcgcgcgtc
gagcagaagtggctcgaaaaggcgctcaagccgttcctgccggaaaaatccgaccgcgac
gagcaggagaacgccgacctgaacaagatcgacctggacaagccactgccgacgacgatc
gctgaatgcaagaaccacccgctgtacgtgctgaagcgtcacctgctcaagttcgaagcg
ctctacccggtggaagtgccaagcttgggctttgtccgcggtgaagcgatctacgcgcgc
gagtgcgtctttgtgctgaagacccgtgagaagtggtacaaagagggcagggtcgttaag
ccgttcgagaccgcgtacaaggtggtcaagtgctggaggtacgacaaggagaagaacgag
tggctcggcaaccagccgtgcgatatcttcgggatctggcagaccgatgagtacgatccg
ccgacggcggagaacggagtggtcccgaggaacgagtacggcaacgtggagctgtttacg
cccaagatgttgcccaagaagacggtgcatctgcagcttccgggtttgaaccgcgtgtgc
cgccggctgggcatcgactgtgcgcccgcgttgaccggcttcgagaaggcccgcatgcgg
atgattcccgtgtacgatgggttcgttgtgtgtgaggagtttggggaccaggtcaccgag
gaatggtacaaagagatggaggaggaggagaggcgcgagcaggaaaagctggaaaagcgc
gtctacggcaactggaagaagctcatcaggggcgtgctggtgcgccgcaagctgcagaac
aagtacaattttgacaatctgtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003593
Entry
CpipJ_CPIJ003593  CDS       T01079                                 
Name
(GenBank) DNA repair protein xp-c / rad4
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ003593
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003593
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      CpipJ_CPIJ003593
SSDB
Motif
Pfam: Transglut_core PhrC_PhrF
Other DBs
NCBI-ProteinID: EDS39774
VectorBase: CPIJ003593
UniProt: B0W977
AA seq 899 aa
MNRARRSVTVKKKVATPPAKVAADSDDDFESEEEESGADFSASEDEWLPGKGDKKQKAGT
ESDGEESAEVDEDEEEDDPSGDGSGSDESVVATKKAKVKRSGKGSPKQPAKKKRMSPKTR
DELYSRTKKYLLKERDPELPPLNSSVSDILKSCQFQKKKHFTTSQAEPKRLKSVARNDES
ESSGDEHLINPEKLDLNSDFFNRQEKLEERAVAVPQFDCNAGMNLSDSSDGEEANEGKLP
ASIPKLAADQLISKINESSSGFMNFNNLGEFNKKIQEAKDMLRITRRRSRRRARTKMFQI
YWLWASQPDIESEESDWEEVEEARKSQASEEKQAGDADYQITVEVEGTKTKKKRWEEIEM
ELYIKRQINKVKREKQLAYHKSSVLCCIAEGRKLNEIVGSGRVQAMMLSCMQAKQCTLKG
KVDVKFVDQLMGWFKDTFQLTSQQMLGEKQSSLKFTLALELFTRKVSCKRNYVLLFLACL
RAAGIHCRLVISANAPPKRPAMKDLCPISERQLIEQFEREFKGKVRSGEDSTVDTSVKEE
DTTVEVKEEAKEEVEEKQSDKKPAKSARVPKVLIEKLDVKTNETAETSSVKKPSRSSRVP
KVLVEKLEVKTQSRSRLQTAKTDEQSRKLRFSPEPELLGADHKSATPSPSKENPKTRKSI
LKAGASPRISSRKALNTLNIPQLDGMDDIPANSPRRRNLRSSDKASKPETSNDLPFAKRN
TNTPQATTSKQIPKQPGRVSKRKLFTTSKTVEPEAEPAKKPKPTKNKILSSDSEPEQELP
KSQSSPALSKKRKAKGAAKLADPESDDSDFEPAGDKRKKVAAKRTRVGSETPEVKKKKSA
PARKGKKKVEIAEKEADISNSAGTNKTDVWIEFYAEKEKQWKTVDLFAGKVDCAEYLAA
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgaaccgcgcccgtcgcagcgtgaccgtgaagaagaaggtggccacaccgccggccaaa
gtggccgccgacagtgacgacgatttcgagagtgaggaggaagaaagtggggcggacttt
tccgccagcgaggacgaatggctgccggggaagggcgacaaaaagcagaaggccgggacg
gaatccgacggggaggagtcggcagaggttgatgaagatgaggaggaggacgaccctagc
ggggatgggtccgggagtgacgaaagcgtcgtggctactaaaaaggcgaaggttaagagg
tccgggaagggatctccgaaacagccggccaagaagaagcggatgtccccgaagactcgt
gatgagctgtattcgcgcaccaagaagtacctgttgaaagagagagatccggagctgccg
ccgttgaactcgagcgtgtcggacattctgaaaagttgtcaatttcaaaagaagaaacat
tttacgacatctcaggcggaaccgaagaggttgaagtccgttgcgcggaacgatgagtcc
gagagcagtggcgacgagcatttgattaacccggaaaagctggacttgaactcggatttc
ttcaaccggcaagagaagttggaggaacgagctgtggcggtgccacagtttgactgtaac
gccggcatgaacttgtcggatagttcggacggggaggaggcgaatgaaggcaaacttccg
gcgtcgatcccgaagctggccgcagatcagctgatcagcaagatcaacgaatcgtcgagc
gggtttatgaactttaacaatttgggagaattcaacaagaagattcaggaagcgaaggac
atgctgagaattaccagacgaaggagtcgcaggagggcaaggacgaagatgtttcaaatt
tattggctctgggccagccaaccggacattgagagtgaagaatcggactgggaggaagtt
gaggaggctcggaagagtcaggcttcggaggagaagcaagctggcgatgctgactatcag
ataacggttgaggtcgaggggaccaagacgaagaagaagcggtgggaagagatcgagatg
gagctgtacattaagcggcaaatcaacaaggtaaagcgggagaaacagttggcttaccac
aagagcagcgttctttgttgtatcgccgaaggtcgtaaactgaacgagattgtgggctcg
ggaagggttcaggcgatgatgctgtcctgtatgcaggccaagcagtgcacgctcaagggg
aaggtcgacgtgaagtttgtcgatcagctgatgggttggttcaaggacacgttccagctc
acgagtcagcagatgctgggggagaagcagtccagcttgaagtttacccttgccttggag
ttgtttacgcgaaaggtgtcctgcaagcgtaactacgttctgctgtttctggcctgtttg
cgagctgctggaattcactgcagactggtcatttccgcgaacgccccaccgaaacggccg
gccatgaaagatctttgtccgatttccgagcgtcagctgattgagcagttcgagcgtgag
ttcaagggtaaagttcggagcggcgaagactcgacggttgatacgagtgtgaaggaagag
gatacaaccgttgaagtgaaggaagaagctaaggaagaggtcgaagagaaacaatcggac
aagaaacctgccaaatctgctcgggttcctaaggtattaattgagaaactggacgtgaag
acaaatgaaaccgctgaaacctcctcagtcaaaaagccttcgagatcgtcgcgagttcca
aaagtgctagttgagaaacttgaagtgaaaactcaaagccgctcccgattgcaaacggcc
aaaaccgatgagcaatcgcgcaagctgcgcttcagccccgaaccggaactcctgggcgca
gatcacaaatcggccacaccaagtccttccaaggaaaacccaaaaacgcgaaagagtatc
ctcaaagctggcgcctcaccgagaatttcatcccgaaaggctctgaacacgctcaatatc
ccgcagctggacggtatggacgacattccggccaactcaccccgaagacgaaatcttcgt
agcagcgataaggcatcgaagccggaaacctccaacgacctgcccttcgccaagcgtaac
accaacacaccacaagcgacgacttcaaagcagatccccaagcaaccgggacgagtctcc
aagcgcaagctgttcacaacgtcgaaaaccgtcgaaccggaagcggaacccgccaaaaag
cccaaaccaacaaagaataaaattctgtcgtccgattcggaaccggaacaggagctacca
aaatcgcagtcttcgccggcgttgagcaagaagcgcaaggcaaagggtgccgccaagttg
gcagaccccgaatcggacgacagtgactttgaacctgccggcgacaagaggaagaaggtg
gcggcgaagcggacccgagttggctcggagacgcccgaggtgaagaagaaaaaatcggcg
ccggcgaggaagggcaagaagaaggtggagatcgcggaaaaggaagcggacatctcgaac
tcggcggggacgaacaagacggacgtgtggatcgagttttacgctgagaaggagaagcag
tggaaaacggtggatctgtttgccgggaaggtcgactgtgcggagtatctggcggcttaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015737
Entry
CpipJ_CPIJ015737  CDS       T01079                                 
Name
(GenBank) DNA repair protein xp-c / rad4
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ015737
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ015737
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      CpipJ_CPIJ015737
SSDB
Motif
Pfam: BHD_3 Rad4 BHD_1 BHD_2
Other DBs
NCBI-ProteinID: EDS42448
VectorBase: CPIJ015737
UniProt: B0X8B2
AA seq 1030 aa
MASDSEPESPPEFSASEDEWNPDQEEKKITGFKAAAAPVKRKKQQVRQLPTRSSRRIATK
LGKELPKEAIVEAVPELPPEEDDAVSTDGEEVVSKKRKQPVAKGRKGRKPKQVVATVAKE
DSIKLTTFTVEELYRKYRPDLAEPAKQEKVKVVKRKVREEDDQDDDDESSGDDYLVDPDE
LDLNSEFFNSVTSKEDGKGRGEVKFDCNAGVSVAESEDDDAEDKPLSSVKNAEVDSTEFN
KKLIQQINQSSQDCMTMVKLVEVSKRIEREREEMDLLRRKREQKEVKKGEEDVSNLLLAG
EKVKGKVVKHSGRSDFVAVDGGKKDKDREKTVEITLKFESAEQNGRSGKKKMDLLTAIKR
MMNREKRQNQIYLHKVSVLCWIGHGTFLNRTLSNANLIKAINKRLLPSTTNCRPKGLTNL
HYFEQVTRYFRKAVRLKNHVMYFHPPNSAKLPPLSATLKYQILQRSAFSKRDYILLYLLM
LRSLSIHCRLIISLPVPPKHVPTSDLYRMNPQTREELEADRRLLLDFRRAHLAPKGSTIR
KVKTQLTAMVDKTVEARRKEAARKRRREGFCATIPQLDGGHDHLPEPKPRKQLKLMESSF
LEIEQNIARKLQGKTKPAKKPSTDKDPIPFPDELDEQVRARREKILAAYKASKEQKAAAA
AAAKAAQEEYCGEGCSSSSSPRRGRRPGKRNVTRSGIDLWVEVYCEHEDKWVTVDVISGM
NQASHPISYVLAWNNDGSIKDVSPRYISRLGTKKSKLRVEDSWLERALVGRNGRRRHPSR
RDRTEDLKFDKLLNKRPFPEQIAEFKNHPRFAIQRHLLKNEAIYPRDAVVLGHFKGEPIY
PRDCVHLLFSREGWLRQAKTVRMFEEPYKVVTRKAKYDRVTGTTVTGLNTELFGEWQVQD
YEPPTAQNGQVPRSAYGNVELFKPCMLPKGTVHLQLPGLNKICKRLRVDCAPAITGFEYR
NNACAAVYDGYVVCEEFRDVVLDEWYQEQVEEQRKQEEKRLKRIYGNWKRLVAGLFIRKK
LKDRYNFDNM
NT seq 3093 nt   +upstreamnt  +downstreamnt
atggcctccgacagcgagccggaatcgccgccagaattttccgccagcgaagacgagtgg
aacccggaccaggaggagaagaaaataaccggtttcaaagccgcagcagcgccggtcaag
cgaaaaaagcaacaagttaggcagcttccaacgcgttcatcccgccgaattgccaccaag
ttggggaaggagctgcccaaggaggcgattgtggaagctgtgccggaactgccacctgaa
gaggatgacgcggtgtcgacggatggggaggaggtcgtttcgaagaagaggaagcaaccg
gtggcgaagggtaggaagggacgcaagccgaagcaggtggtggcgacggtggccaaggag
gattcgatcaagctgacgacgtttacggtggaggagttgtatcggaagtatcggccggat
ttggcggaacctgcgaagcaggagaaggtaaaggtggttaagaggaaggtgagggaggag
gacgatcaggatgacgatgatgagagcagcggggacgattatttggtcgatccggatgag
ctggatttgaattcggaatttttcaattccgttacttcaaaggaggatggaaagggacgg
ggagaggtcaagtttgattgcaatgccggggtgagtgtggccgagtcggaggatgatgat
gcggaggataagccgctgagttcggtcaaaaatgccgaagtggactcgacggagttcaac
aagaagctgattcagcagattaaccagtctagccaggattgcatgacgatggtcaagttg
gttgaggtttccaagcggatcgagcgagaacgtgaagagatggacctgctacggaggaag
cgcgagcagaaggaggtcaagaagggagaggaggacgtttcgaacttgctgttggcgggg
gagaaagttaaggggaaggtcgtgaagcattccggaaggagcgactttgttgcggttgat
ggaggtaagaaagataaggaccgggaaaagacggttgagataacgttgaagtttgaatct
gcggagcagaatgggaggtcgggcaagaaaaagatggacctgctgaccgcgattaagcgg
atgatgaatcgcgagaagcgacagaaccaaatctacctgcacaaagtgtccgttctttgc
tggattggccatgggacgttcctcaatcgaacgcttagcaacgccaaccttatcaaagcg
atcaacaaacgtctactgccctctacgaccaactgccggccaaaaggcctcaccaatctg
cattatttcgagcaggtcacgcgttacttccgcaaggccgtacgcctcaagaaccacgtc
atgtacttccacccaccaaacagcgccaaactgccacctctctccgccaccctcaagtat
cagatccttcagcgatcggccttctccaagcgcgactacattctcctttacttgttgatg
ctccgctcgctttcgattcactgccgactcataatctcccttccggttcccccaaagcac
gtcccaaccagcgacctctaccgcatgaatccacaaacgcgcgaagaactcgaagccgac
cggcgtctcctgctagacttccgacgcgcccacctcgcccccaaaggaagcacaatccgc
aaagtcaaaacccagctgaccgccatggtcgacaaaaccgtcgaagctcggcgcaaggaa
gcggcccgaaagcgccgtcgcgaaggcttctgtgccaccatcccccagctggacggcggc
cacgaccacctgccggaaccgaaaccgcgcaagcagctgaagctgatggagagttccttc
ctcgagatcgagcagaacatcgcgcgaaagttgcaaggcaagacgaaaccagcgaaaaaa
ccgtcaaccgacaaagacccaattcccttcccggacgaactcgacgagcaggtgagggcg
cgccgcgagaagatcctggccgcgtacaaggcctccaaggagcagaaggcggcggcggct
gcggccgccaaggcagcgcaggaagaatactgcggagaagggtgcagctcgtcgtcgtcg
ccgagaagggggcgtcgtcccggcaagcggaacgttacgcgctccgggattgacctctgg
gttgaggtgtactgcgagcacgaggacaagtgggtcacggttgatgtcatatctgggatg
aaccaagccagccacccgatctcgtacgtcctagcgtggaacaacgacggttccatcaag
gacgtgtccccacgctacatttcccggctcggcaccaaaaagagcaaacttcgcgtcgaa
gacagctggctcgaacgggcgttagtcggtcgtaacggccgtcgccgccacccatcccgc
cgcgaccgcaccgaagatctcaagttcgacaagctgctcaacaagcgacccttcccggaa
cagatcgccgagttcaaaaaccatccccgctttgcgatccaacgccacctgctcaaaaac
gaagcaatctacccgcgggacgccgtcgtcctcggccacttcaagggcgaaccgatttac
ccccgcgactgcgtacacctcctgttttcccgtgaaggttggctgcggcaagccaaaacc
gtccgcatgttcgaggaaccgtacaaagtggtcacgcgcaaggcgaaatacgatcgcgtt
accggcaccaccgtcaccggactcaacacggaactgtttggcgagtggcaagtccaggac
tacgaacctcccaccgcacagaacggccaagttcctcggtccgcgtacggcaacgtcgaa
ctctttaagccgtgcatgctgccgaaagggacggtccacctccaactgcccggactcaac
aaaatttgcaaacgactccgcgtggattgtgcgccggccatcaccgggttcgagtatcgg
aacaatgcttgtgcggccgtctacgacgggtacgtcgtgtgtgaggagttccgcgatgtg
gttctggacgagtggtaccaggagcaagttgaggagcagcggaagcaggaggaaaagcgc
ctcaagcggatctacggaaactggaagcggttggtggcgggactgttcatccggaagaag
ctcaaagatcggtacaactttgataacatgtag

DBGET integrated database retrieval system