KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003597
Entry
CpipJ_CPIJ003597  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ003597
   03410 Base excision repair
    CpipJ_CPIJ003597
   03420 Nucleotide excision repair
    CpipJ_CPIJ003597
   03430 Mismatch repair
    CpipJ_CPIJ003597
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ003597
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003597
Enzymes [BR:cqu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CpipJ_CPIJ003597
    6.5.1.6  DNA ligase (ATP or NAD+)
     CpipJ_CPIJ003597
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CpipJ_CPIJ003597
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    CpipJ_CPIJ003597
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     CpipJ_CPIJ003597
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CpipJ_CPIJ003597
   NER (nucleotide excision repair)
    Other NER factors
     CpipJ_CPIJ003597
   MMR (mismatch excision repair)
    Other MMR factors
     CpipJ_CPIJ003597
SSDB
Motif
Pfam: DNA_ligase_A_N
Other DBs
NCBI-ProteinID: EDS39778
VectorBase: CPIJ003597
UniProt: B0W981
AA seq 394 aa
MTRNRHLHGQGHENGQKHGHEHGQESGQGHGLEHGQGNDQEQATMCAGKKPKLEASFTDE
PAAGTQVDEVELCRSVRRKHRESQKSPSDSMPRGGEKYTKKHIVKVYQGLCRVHGSSKLA
EKKKKREPSESPKRRKCVCGESGRLQEQQDGVQYGTKGYHPLENAFWRKSETVTCLARTF
QIIEKTSERLRMIKILANYFWSVILSPDDLLARRQAGHCGALVDDAIKQSTGRSLAQILM
DAQTTADQSKSSHRMMFRPAPLSVKDVFGKLRKIIKMTVTDDGQDLVDVCGGLTRFASVE
KLPKAKVEDVALVLKTIVPLLLVDKCSMMPGTPLRPVLAHPPKGVQKVLERFDGIDLSAS
GSTTEIVRLSTCWRTAALTSTVGTRRTTRACTRT
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaccaggaacagacacctacacggccagggacacgaaaacggccagaagcacgggcac
gaacacgggcaggagtccggacaaggacacggcctagagcacggccaagggaacgaccag
gaacaggcaactatgtgcgccggcaagaaacccaaactggaggcttccttcaccgacgaa
cctgcagccgggacgcaagtcgacgaagtggaattgtgtcgttcagtgaggaggaaacac
cgggaaagccagaaatccccgagcgacagcatgccaagaggaggagaaaaatacacaaaa
aagcacatcgtcaaagtctatcaaggactctgcagagtccatggatcgtccaagttggct
gaaaagaagaagaagcgcgaaccgtcggaatcgccgaaaaggagaaaatgcgtttgcggc
gagtccggccgcctccaagaacaacaggacggagtacaatacgggacaaagggttaccac
ccgctggagaatgcgttttggcggaagagcgaaacggtgacgtgcttggcgcggacgttc
cagatcatcgagaagactagcgagcggctgcggatgatcaagattctggccaactacttc
tggtcggtgattctgagtccggacgatctgctggcgaggcgtcaagctggacattgcgga
gcactcgttgatgatgcgattaagcagagcacgggccgaagtttggcgcaaatcttgatg
gacgcacagacgacggcggatcagagcaagagtagccatcggatgatgttccggccggcg
ccgctttcggtcaaggacgtgtttggaaagttgaggaagattatcaagatgactgtcacg
gatgatggacaagatttagtcgatgtttgtggcgggttgacacggttcgcaagtgtggaa
aagcttccgaaggcgaaggtggaggatgttgcgttggtgctgaagacgattgtaccattg
ctgctggtggacaagtgttcgatgatgccgggaacaccgttgaggcccgtattggcgcat
ccgcccaagggcgttcagaaagtgttggagcgattcgacgggattgatttaagtgcgagt
ggaagtacgacggagatcgtacgcttatccacctgctggagaacggcagcgttaacatct
acagtcggaactaggagaacaacacgagcatgtaccaggacgtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009862
Entry
CpipJ_CPIJ009862  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ009862
   03410 Base excision repair
    CpipJ_CPIJ009862
   03420 Nucleotide excision repair
    CpipJ_CPIJ009862
   03430 Mismatch repair
    CpipJ_CPIJ009862
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ009862
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ009862
Enzymes [BR:cqu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CpipJ_CPIJ009862
    6.5.1.6  DNA ligase (ATP or NAD+)
     CpipJ_CPIJ009862
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CpipJ_CPIJ009862
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    CpipJ_CPIJ009862
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     CpipJ_CPIJ009862
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CpipJ_CPIJ009862
   NER (nucleotide excision repair)
    Other NER factors
     CpipJ_CPIJ009862
   MMR (mismatch excision repair)
    Other MMR factors
     CpipJ_CPIJ009862
SSDB
Motif
Pfam: DNA_ligase_A_N
Other DBs
NCBI-ProteinID: EDS33361
VectorBase: CPIJ009862
UniProt: B0WRG8
AA seq 694 aa
MSRVEQARAVVRLARSKVFPTAVEVQPGLRSLLVLLLSHLWMHYGHCYSMEVLQSVETAA
VVATAAATDYDANFPKLYDALELTGDDTAAPRINAPAVPCDPPGPCPRPRPLRLTTPDSG
ALHQPHRDRHDSGHHFRRLQHHHLSSSQEFEQVLVRLRICVKVVVDLRLQLLGDDRSSGQ
QHLLYQLLFHYFPISCDTVLLFNFLFAAVPPKTTKTNTRDVKRSYQCDVKREFLSHKNSV
GTRLLLVPLQMTKSFSYAGCKRSPNSNTVSSDSSRTNSCLLWKVVCFCFFVTSVVCSAGK
KPKLVASSTEESAAGTPSSVKKSPSDSIPGGGKKCIESPDPDRVHGSFKSAKKKTFTVVK
KEVKREPSESPKRREGGCGESGRLQELRDGVQYGRKFWPNGETVTCLARTLQIIEWLRMI
EILANYFCSVILILSPDDLLLEPACLAPAYAGVELDMTGVLVDDAIRQSTGRSLAQILMD
AQTTRDLGLVAEQSKSSYRMMFRPAPHAVNDVFGKLRKINKMTGTDDGQDSVDVWAASVR
KLSKAKVEDIALVLKTESVNQIVQLLLEDGVVHLVDKCSMMPGTPLKFMLAHPTKGVQEV
LERFGGRQREHLQLELGEQHEHVPGSLPGLTALGRVQEYIPGLRNIVGVEQISYPPTIKT
TWWKHHPPVPDAEKLQDHLIKARSPGSSAGDTKD
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgtcacgggttgagcaggcacgagctgttgtacggctagcccgctcgaaggtgttcccg
actgctgtggaggtacagcccggactgagatctctgctggtgttgttgttgtcacacctg
tggatgcattatggccactgctactcaatggaggtcctccaatcagttgagactgctgcg
gttgttgctactgctgctgctacagactacgatgcgaacttcccgaagttgtacgatgct
ttggagctaaccggcgatgatacggcagctccacgcataaacgctccggcagtgccatgt
gatccgccgggtccatgcccgagaccccgacctctccgactcacgacgcctgatagtggt
gctctccaccaaccacatcgtgaccgtcatgactctgggcaccacttccgccgcctccag
caccaccacttaagttcgtcgcaagagttcgagcaagttctcgtgcgcctgcgcatttgc
gtgaaggttgttgttgatcttagactccagttgctgggcgatgacagatcctctggccag
cagcatctcctgtatcagctacttttccactactttccgatctcctgcgacaccgttctt
cttttcaactttttgtttgcggcagttccacccaaaacaacaaaaacaaacacgcgcgat
gtcaaacggtcgtaccaatgtgatgtaaaaagagaattcttaagccacaaaaattccgtc
gggacccggttgctgctggtgccactgcaaatgacgaagtcattttcgtacgccggatgt
aaaagaagtcccaactccaacacggtgtcatccgacagcagcagaacaaacagctgttta
ttgtggaaggtcgtttgtttttgttttttcgtcacgtccgtggtctgcagcgccggcaag
aaacccaaactggtggcttcctccaccgaagagtcggcggccgggaccccctcatcggtc
aagaaatccccgagcgacagcattccaggaggaggaaaaaaatgtatagaaagtccagat
ccagacagagtccatggatcgttcaagtcggctaaaaagaagacttttaccgttgtaaag
aaggaagtgaagcgcgaaccgtcggaatcgccgaaaaggagagaaggcggttgcggcgag
tctggccgcctccaagaactacgggacggagtacaatacgggagaaagttctggccaaac
ggcgaaacggtgacgtgcttggcgcggacgttacagatcatcgagtggctgcggatgatc
gagattctggccaattacttctgctcggtgattctgattctgagtccggacgatctgctg
cttgaaccggcttgcttggcgccggcgtacgcgggcgtcgagttggacatgacgggagta
ctcgttgatgatgcgattaggcagagcacgggccgaagtttggcgcaaattttgatggac
gcacagacgacgagggatttgggcctggtggcggagcagagcaagagtagctatcggatg
atgttccggccggctccgcacgcagtcaacgacgtgtttgggaagttgaggaagattaac
aagatgacggggacggacgatggacaagattcagtcgatgtttgggcggcaagtgtgaga
aagctttcgaaggcgaaggtggaggacattgcgttggtgctgaagacggagtccgtcaac
cagattgtacagttgctgctggaggacggggtggttcacctggtggacaagtgttcgatg
atgccgggaacacctctgaagttcatgttggcgcatccgaccaagggcgttcaggaagtg
ttggagcgattcggaggacggcagcgtgaacatttgcagttggaactaggggaacaacac
gagcatgtacctggaagtttgcccggtttgaccgcactcggaagggttcaagagtacatt
cctggactacgaaatattgttggtgttgagcagatctcataccccccaacgataaaaacg
acttggtggaagcatcatccgccggtacctgatgcggagaaactccaggaccatctaata
aaagctcgatctccgggaagttccgctggggacaccaaagattga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015371
Entry
CpipJ_CPIJ015371  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ015371
   03410 Base excision repair
    CpipJ_CPIJ015371
   03420 Nucleotide excision repair
    CpipJ_CPIJ015371
   03430 Mismatch repair
    CpipJ_CPIJ015371
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ015371
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ015371
Enzymes [BR:cqu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CpipJ_CPIJ015371
    6.5.1.6  DNA ligase (ATP or NAD+)
     CpipJ_CPIJ015371
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CpipJ_CPIJ015371
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    CpipJ_CPIJ015371
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     CpipJ_CPIJ015371
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CpipJ_CPIJ015371
   NER (nucleotide excision repair)
    Other NER factors
     CpipJ_CPIJ015371
   MMR (mismatch excision repair)
    Other MMR factors
     CpipJ_CPIJ015371
SSDB
Motif
Pfam: DNA_ligase_A_N
Other DBs
NCBI-ProteinID: EDS42158
VectorBase: CPIJ015371
UniProt: B0X7T9
AA seq 381 aa
MKPRGEMWKRAWTCRGDNKKSSKSSDRILGKTNAGKKPKLEASFTDEPAAGTQVDEVELC
RSVRRKHRESQKSPSDSMPRGGEKYTKKHIVKVYQGLCRVHGSSKLAEKKKKREPSESPK
RRKCVCGESGRLQEQQDGVQYGTKGYHPLENAFWRKSETVTCLARTFQIIEKTSERLRMI
KILANYFWSVILSPDDLLARRQAGHCGALVDDAIKQSTGRSLAQILMDAQTTADQSKSSH
RMMFRPAPLSVKDVFGKLRKINKMTGTDDGQDSVDVCGGLTRFASVEKLPKAKVEDVALV
LKTIVPLLLVDKCSMMPGTPLRPVLAHPPKGVQKVLERFDGIDLSASGSTTEIGRLSTCW
RTAALTSTVGTRRTTRACTRT
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaagcctcgtggagagatgtggaagcgcgcctggacctgccgtggagataacaaaaag
tcgtcgaagtcatcggatcgaatcttgggaaagacaaacgccggcaagaaacccaaactg
gaggcttccttcaccgacgaacctgcagccgggacgcaagtcgacgaagtggaattgtgt
cgttcagtgaggaggaaacaccgggaaagccagaaatccccgagcgacagcatgccaaga
ggaggagaaaaatacacaaaaaagcacatcgtcaaagtctatcaaggactctgcagagtc
catggatcgtccaagttggctgaaaagaagaagaagcgcgaaccgtcggaatcgccgaaa
aggagaaaatgcgtttgcggcgagtccggccgcctccaagaacaacaggacggagtacaa
tacgggacaaagggttaccacccgctggagaatgcgttttggcggaagagcgaaacggtg
acgtgcttggcgcggacgttccagatcatcgagaagactagcgagcggctgcggatgatc
aagattctggccaactacttctggtcggtgattctgagtccggacgatctgctggcgagg
cgtcaagctggacattgcggagcactcgttgatgatgcgattaagcagagcacgggccga
agtttggcgcaaatcttgatggacgcacagacgacggcggatcagagcaagagtagccat
cggatgatgttccggccggcgccgctttcggtcaaggacgtgtttggaaagttgaggaag
attaacaagatgactggcacggatgatggacaagattcagtcgatgtttgtggtgggttg
acacggtttgcaagtgtagaaaagcttccgaaggcgaaggtggaggatgttgcgttggtg
ctgaagacgattgtaccattgctgctggtggacaagtgttcgatgatgccgggaacaccg
ttgaggcccgtattggcgcatccgcccaagggcgttcagaaagtgttggagcgattcgac
gggattgatttaagtgcgagtggaagtacgacggagatcggacgcttatccacctgctgg
agaacggcagcgttaacatctacagtcggaactaggagaacaacacgagcatgtaccagg
acgtga

DBGET integrated database retrieval system