KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003679
Entry
CpipJ_CPIJ003679  CDS       T01079                                 
Name
(GenBank) DNA repair protein RAD51
  KO
K04482  DNA repair protein RAD51
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ003679
   03460 Fanconi anemia pathway
    CpipJ_CPIJ003679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cqu04131]
    CpipJ_CPIJ003679
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ003679
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ003679
Membrane trafficking [BR:cqu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    CpipJ_CPIJ003679
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    CpipJ_CPIJ003679
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     CpipJ_CPIJ003679
    RecA family proteins
     CpipJ_CPIJ003679
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     CpipJ_CPIJ003679
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase DnaB_C AAA_28 HHH AAA_22 PAXNEB
Other DBs
NCBI-ProteinID: EDS40393
VectorBase: CPIJ003679
UniProt: B0W9S4
AA seq 349 aa
MAAAQQAQKPAKEKTAAAAAPTVEEEEDDYGPILIGKLEGNGITSGDLKKLGEAGFHTVE
SVAFAPKKQLIAIKGISEAKADKIILEASKLVPLGFTTATEYHQKRSEIIQLTTGSKELD
KLLGGGIETGSITELFGEFRTGKTQLCHTLAVTCQLPVSQNGGEGKCLYIDTEGTFRPER
LLAVADRYKLVGSDVLDNVAYARAYNSDHQMQLLVQASAMMAESRYALLIVDSATALFRT
DYAGRGELNARQVNLGKFLRMLLRLADEFGVAVIITNQVVAQVDASAMFTPDPKKPIGGH
IIAHASTTRLYLRKGRGETRVCKIYDSPCLPESEAMYAINADGIGDAKE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcagctgcccagcaagcacagaaaccggcgaaggaaaagaccgcggccgctgcggcc
ccaacggttgaggaggaggaggacgattacggtccgattctgatcggaaagttggagggc
aacggaatcaccagcggtgacctcaagaagctcggcgaggccggatttcacacggtggag
tcggtggccttcgcaccgaaaaaacaactcatcgccatcaagggaatctccgaggcgaag
gcggacaaaatcattctcgaagcgtccaagctggttccgcttggcttcacgaccgccacc
gagtaccaccagaagcgctcggaaatcatccaactgaccaccggctcgaaagagctggac
aagctgctgggaggaggaatcgaaactggaagcatcaccgagctgttcggggagttccga
acgggcaaaacccaactctgtcacacgctggccgtgacctgccagctgccggtcagtcaa
aacggcggagaaggcaagtgtctgtacatcgacacggaaggaaccttccggccggagcga
ctgctagccgttgccgatcgctacaaactggtcggttccgacgtcctggacaacgtggcg
tacgcccgagcctacaactccgaccaccagatgcaactgctcgtgcaggcctccgcaatg
atggccgaatcccgttacgccctgctcatcgtggacagcgcaaccgccctcttccgaacc
gattacgccggccgcggagaactcaacgcgcgccaggtcaacctcggtaaattcctccgg
atgctgctccgtctcgcggacgaattcggtgtggccgtcatcatcacgaaccaagtcgtg
gcccaagtggatgcgtccgccatgtttacgccggatccgaagaagcccatcggaggccac
atcatcgcgcacgcctcgacgacgcggctttacctgcgcaagggtcggggcgagacgcga
gtgtgcaagatttacgattcgccgtgcctcccggaaagtgaagccatgtacgcgatcaac
gcggacggaattggcgatgccaaggagtga

DBGET integrated database retrieval system