KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004000
Entry
CpipJ_CPIJ004000  CDS       T01079                                 
Name
(GenBank) endonuclease iii
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ004000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ004000
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CpipJ_CPIJ004000
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CpipJ_CPIJ004000
 Prokaryotic type
     CpipJ_CPIJ004000
SSDB
Motif
Pfam: HhH-GPD HHH
Other DBs
NCBI-ProteinID: EDS40881
VectorBase: CPIJ004000
UniProt: B0WA52
AA seq 363 aa
MVCESKSPYFSPKKTRNFVKQSGLKATLLQKAIQAREVTPEPVASTSVNEKASVPSVPQI
KIEPLDDPPEKKPRAPRRKPIKVESSPDRRQGDDPQVDVVVHKSPRKRTPIKEEWVEGWE
PVNWRPMLENIRRMRLERPAPVDSMGCDQFRDDVTVPPKTRRFHTLVSLMLSSQTKDQAN
FECMQRLRKHGLTPEQMVATDVETLEKLIHPVSFYKNKAKFIRQTSALLLSTYDGDIPDT
IEGLMKLPGVGAKMAHLCMGAAWNIVTGIGVDTHVHRISNWLGWVPRETRTPEETRLLLE
RWLPFELWEEVNHLLVGFGQTICTSTYPRCNECGNAEICPARGKHGIRRTPIKKEIKQEE
LEF
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggtgtgcgaatccaaatcgccatacttttctcccaagaaaacgcgaaacttcgtcaag
cagtccggtttgaaggccactttgctgcaaaaagcgatccaagcccgagaggtcactccg
gaaccggtggccagcacgtccgtcaatgaaaaggcatcggttccatcggtcccccagatc
aaaatcgaaccgctggacgatccgccggagaagaaacctcgcgctccacggcgcaaacca
atcaaggtcgagtcgagtccggatcgacgacagggtgatgacccgcaagtggatgtggtc
gtccacaagtcgccccggaagcgcactcccatcaaggaggaatgggtcgaaggctgggag
ccggtcaactggcgcccaatgctggaaaacattcgccggatgaggctggaacggccggct
ccggtcgattctatgggctgtgaccagtttcgggatgatgtaacggttccgcccaaaacg
cggcgcttccacacgctggtttcgctgatgctttcgagccaaaccaaggatcaggccaac
tttgagtgcatgcaacggctgcgcaagcatggcctaacgccagaacagatggtggccacc
gacgtcgagacgctggagaagctcattcatcccgttagcttctacaagaacaaagccaaa
ttcatccgccaaacgtccgcgctgctactgtccacgtacgacggtgacatcccggacacc
atcgaaggactcatgaagctgcccggagtgggcgcaaagatggcgcacctgtgcatgggc
gccgcctggaacatcgtgaccggcatcggcgtcgacacccacgtccaccgcatctccaac
tggctcggttgggtgccgcgggagacgcgcaccccggaggaaacccgccttctgctcgag
cgctggcttccgttcgaactgtgggaagaggtgaaccatctgctggtgggattcggtcaa
accatttgtacctcgacgtacccacggtgcaacgagtgcggcaacgcggaaatatgcccg
gcccgtggcaagcacggcattcggcgcacgccgatcaagaaggagattaagcaggaggag
ttggagttttga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016010
Entry
CpipJ_CPIJ016010  CDS       T01079                                 
Name
(GenBank) endonuclease iii
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ016010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ016010
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CpipJ_CPIJ016010
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CpipJ_CPIJ016010
 Prokaryotic type
     CpipJ_CPIJ016010
SSDB
Motif
Pfam: HhH-GPD HHH
Other DBs
NCBI-ProteinID: EDS44288
VectorBase: CPIJ016010
UniProt: B0XBH6
AA seq 361 aa
MESKSPYFSPKKTRNFVKQSGLKATLLQKAIQAREVTPEPVASTSVNEKASVPSVPQIKI
EPLDDPPEKKPRAPRRKPIKVESSPDRRQGDDPQVDVVVHKSPRKRTPIKEEWVEGWEPV
NWRPMLENIRRMRLERPAPVDSMGCDQFRDDVTVPPKTRRFHTLVSLMLSSQTKDQANFE
CMQRLRKHGLTPEQMVATDVERLEKLIHPVSFYKNKAKFIRQTSALLLSTYDGDIPDTIE
GLMKLPGVGAKMAHLCMGAAWNIVTGIGVDTHVHRISNWLGWVPRETRTPEETRLLLERW
LPFELWEEVNHLLVGFGQTICTSTYPRCNECGNAEICPARGKHGIRRTPIKKEIKQEELE
F
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggaatccaaatcgccatacttttctcccaagaaaacgcgaaacttcgtcaagcagtcc
ggtttgaaggccactttgctgcaaaaagcgatccaagcccgagaggtcactccggaaccg
gtggccagcacgtccgtcaatgaaaaggcgtcggttccatcggtcccccagatcaaaatc
gaaccgctggacgatccgccggagaagaaacctcgcgctccacggcgcaaaccaatcaag
gtcgagtcgagtccggatcgacgacagggcgatgacccgcaagtggatgtggtcgtccac
aagtcgccccggaagcgcactcccatcaaggaggaatgggtcgaaggctgggagccggtc
aactggcgcccaatgctggaaaacattcgccggatgaggctggaacggccggctccggtc
gattctatgggctgtgaccagtttcgggatgatgtaacggttccgcccaaaacgcggcgc
ttccacacgctggtttcgctgatgctttcgagccaaaccaaggatcaggccaactttgag
tgcatgcaacggctgcgcaagcatggcctaacgccagaacagatggtggccaccgacgtc
gagaggctggagaagctcattcatcccgttagcttctacaagaacaaagccaaattcatc
cgccaaacgtccgcgctgctactgtccacgtacgacggtgacatcccggacaccatcgaa
ggactcatgaagctgcccggagtgggcgcaaagatggcgcacctgtgcatgggcgccgcc
tggaacatcgtgaccggcatcggcgtcgacacccacgtccaccgcatctccaactggctc
ggttgggtgccgcgggagacgcgcaccccggaggaaacccgccttctgctcgagcgctgg
cttccgttcgaactgtgggaagaggtgaaccatctgctggtgggattcggtcaaaccatt
tgtacctcgacgtacccacggtgcaacgagtgcggcaacgcggaaatatgcccggcccgt
ggcaagcacggcattcggcgcacgccgatcaagaaggagattaagcaggaggagttggag
ttttga

DBGET integrated database retrieval system