KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004184
Entry
CpipJ_CPIJ004184  CDS       T01079                                 
Name
(GenBank) DNA-repair protein complementing XP-G cells
  KO
K10846  DNA excision repair protein ERCC-5
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ004184
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ004184
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     CpipJ_CPIJ004184
SSDB
Motif
Pfam: XPG_N XPG_I XPG_I_2
Other DBs
NCBI-ProteinID: EDS41982
VectorBase: CPIJ004184
UniProt: B0WB24
AA seq 1217 aa
MGVTGLWKLVEQSGKPVPLETLENKVLAVDISIWLHQVTKGFQDSKGSALPNAHVLGLFH
RLCKLMYYRIRPVFVFDGGVPALKRQTIAKRNQSKSKFHNEADRLQQLLLETLAKEKVVQ
QALGSATSLLVSPSKKPGNSSKEQGEPDEMFKLPPLKEDSPFKNADSSATDLDESNSSWD
EKGSKNFYHLNLNAIDVTSVHFKNLPADVRHDILSDIKETRKQSSWGRLHELPVESNNFS
TFQMKRLLKRRTVQVELEEAEKEMGGKCLSLAELEALLSEEGVDTSSDKAAQKIASDENT
RFLLVRDVQKAIEKAKQREEEEKNAPKPPKLPKVEIKKSDDREVEDDKEMDAELQMAIQM
SLMQDVDPNVVIELESEEVRMSRQQKEALGGAAMSLARGYMLEYGGMSNDDVRELLHQTQ
DVDPGEVEQSFTQMFEHNNASILKGTLHPVEEVEEVQEVSSDTDSDFVDVPEDDLGDSPP
GVLLPLNPSNHQKPHFGAVVDFTLNDLPGKAGSESKLVEIFIEPSKIGLKDEDDIFANVF
EVKEEEKAVKVDEKPVEPKLPTIQIKKVDDINAKLKEELERLKAAPPVIDLDDILSQPLI
PKVDSKPAQPEAVHDQVKQQLEQLKSQTPQINLDDIKLDSSLVDEPVAISDAEDSDATVG
YSPIKAVQKALEATGETTYKIIQSDEAKTQEVVPLLGTPKKGTLEHLVVSRTPGSDSKKS
EPEEDIPKVPQPFFVNKTPTSSSKKKSAEDQPTPTKAIKVSKELFPVQDPEPLPSTSSAP
PPSADQLISEMAGDLQKQATPLELKKLSLNLAQQERELEKEKNRQARLGMSITEQMQQDC
MDLLKLFGVPFIVAPMEAEAQCAFLNQIELTDGTITDDSDIWLFGGKTVYKNFFNQQKLV
MEFTIEGIERAFQMDRKKLIQLALLVGSDYTTGISGIGAVTALEVLASFPPTPQKDGETT
EMMSLLSGLRKFRDWWNHGRNNSVRTRITLKSKLKNIEFTEGFPSSAIVEAYLYPTVDGN
KDAFSWGYPDAESLRDFAKQKFGWPQAKTDDILLPVLKRLDERKSQSSIKNYFKVQSAVA
HNQVKVSKRVQQAVDVMAGKEVVEQVKSPKKKVVRKRKPKAEEPKEGEKAAAVKAPAARK
PRATRAKSKAEKTTPDNPELPDKPSSSLANISVQNKIPDFNPAIPQRVKDQEEMANRKQK
AAELFKKTQVKGKKTHK
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgggagtgaccggcctgtggaagctggtggaacaatccggcaaaccggttccactggag
actctcgagaacaaggtgcttgccgttgatatctcgatatggctccaccaggtgactaag
ggcttccaggactcgaagggcagcgccctgccgaacgcacacgtcctcggtctgttccac
cgcctctgcaagctgatgtactataggattaggccggttttcgtgtttgatggtggcgtt
ccggccttgaagcggcaaaccattgccaagcgtaaccagagcaagagcaaattccataat
gaggcagatcggctgcagcagcttctgctggagacattggccaaggaaaaggtagttcag
caggctcttggatcagcgaccagtttgctggtgtctccgtcgaagaagccggggaatagc
agcaaggagcagggtgagccggatgagatgtttaaactgccaccgctgaaggaggattct
ccgtttaagaatgcggacagttcggcgacagatttggacgaaagtaacagctcgtgggac
gagaaggggtcgaagaacttttatcacttgaatttgaacgcgattgacgttaccagcgtg
cactttaagaaccttccggcggatgtgaggcacgacattctgtcggatatcaaagagacg
aggaagcaatcgtcgtgggggaggctgcacgagcttcccgttgagagcaataacttttcg
acgttccagatgaagaggctgctgaagcgccggacggtccaggttgaactggaggaggcg
gagaaggagatgggagggaagtgcttgtctttggcggagttggaggcgttgctttcggag
gagggtgttgacacttcctcggataaagcggcccagaagatcgcttcggatgaaaatacc
cggttcctgttggtgagggatgtccagaaggcgatcgagaaggcgaagcagcgggaagaa
gaggaaaagaatgcgccgaagcctccgaagctgccgaaagttgaaattaaaaagtctgac
gatcgggaagtcgaggacgataaggagatggacgcggagctgcagatggccatccaaatg
tcgttgatgcaggacgtggatccaaacgtggtgattgagctggaatcggaggaggttcgc
atgtcccggcagcagaaggaagctttgggcggagcagcgatgagtttggcccgcggctac
atgctcgagtacggcgggatgtccaacgacgacgtccgggagctgctccatcagacgcag
gacgtggacccgggggaagtcgagcagtctttcacgcagatgttcgagcacaacaatgct
tcgattttgaaggggacgctccatcccgtggaggaagtagaggaggtccaggaagtttct
tcggacacggattcggactttgtggacgttccggaggacgacttgggcgacagtccgccg
ggagtgttgcttccgttgaacccgagcaatcaccagaagccgcactttggcgctgtcgtg
gatttcacactgaacgatctgccggggaaggccggaagtgagagcaaactggttgaaatc
ttcatcgagccgagcaagattggcttgaaagatgaagacgacatctttgcgaatgttttt
gaggtgaaagaggaggaaaaggccgtgaaggtcgatgaaaagcccgtagaaccgaaactt
cccacaatccagatcaaaaaggtcgatgacataaacgccaaattgaaggaagagttggaa
aggttaaaggcagctcctccggtaatcgatctggacgatattcttagtcaaccgttgatt
ccaaaggtcgattccaagccggcccaaccggaagcagttcacgaccaggtcaaacaacag
ctggaacagctcaaaagtcaaacacctcaaatcaacctggacgacatcaagctggacagt
tccctcgtcgatgaaccggtggccatttccgacgccgaagacagcgacgccacggttggc
tactcaccgatcaaagcggtccaaaaggcgctggaagccaccggagaaacgacctacaaa
atcattcaatctgacgaggcaaaaacccaggaagtcgtccctcttctaggaaccccaaaa
aagggcaccctcgagcacctggtcgtgtcccggacacccggtagcgactccaagaaatct
gaacccgaagaggacatcccaaaagttcctcaacccttcttcgtcaacaaaactccaacc
tcttcttcaaagaagaagtccgccgaagatcaaccaactcccaccaaagcaatcaaagtt
tcgaaagagctcttccccgtccaagatccggaaccgctcccctcaaccagcagcgcaccc
cctccctccgccgaccaactaatctcggaaatggccggtgacctccaaaaacaagccacc
ccgctcgagctgaaaaagttgtccctcaacctggcccagcaagagcgcgaactcgagaag
gaaaagaaccgccaggcgcgcctcggaatgtccatcaccgagcagatgcagcaggactgc
atggacctgctgaagctgtttggcgtcccgttcatagtggcaccgatggaggcggaagcg
cagtgtgcgttcctgaaccagatcgagctgaccgacgggaccattacggacgatagcgat
atctggctgtttggcgggaagacggtgtacaagaactttttcaaccagcagaagctggtg
atggagtttacgattgaggggattgagcgggcgtttcagatggaccggaaaaaactgatt
cagctggcgctgctggtggggagtgattatacgacgggcatttccggcatcggcgccgtc
accgccctcgaagttctcgcctcattccccccaaccccgcaaaaggacggcgagaccacg
gaaatgatgtccctcctgtccggcctgcgcaaattccgcgactggtggaaccacggccgg
aacaactccgtccgaacgcggatcacgctcaagtccaagctgaagaacatcgagttcacc
gagggcttcccgagttcggcgatcgtcgaggcgtacctgtacccgacggtggacgggaac
aaggacgccttttcgtggggctatccagacgccgagagtttgcgggactttgcgaagcaa
aagtttggctggccgcaggcgaagacggacgacattttgctgccggtgctgaagcggttg
gatgagcgaaagtcgcagtcgtcgatcaagaactacttcaaggtgcagagcgctgtggcg
cacaatcaggtcaaagttagcaagcgggttcaacaggcggtggatgtgatggccgggaag
gaggttgtcgagcaggtgaagagtcctaaaaagaaggtggtgaggaagaggaagcctaag
gcggaggagccgaaggagggggagaaggcagcagcagtaaaagcaccagcggcgagaaag
ccgagagcaacgagggccaaatctaaggcagaaaagacgacaccggataatcctgagttg
ccagacaagccgtcgtcgtcgttggccaacatttccgttcaaaacaagatcccggacttt
aatccggccattccgcagcgagtcaaagaccaggaggagatggccaaccggaagcagaaa
gcagccgagctgtttaagaagactcaagtcaagggcaaaaagacgcacaagtag

DBGET integrated database retrieval system