KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004237
Entry
CpipJ_CPIJ004237  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10990  RecQ-mediated genome instability protein 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ004237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ004237
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     CpipJ_CPIJ004237
   FA (Fanconi anemia) pathway
     CpipJ_CPIJ004237
SSDB
Motif
Pfam: RMI1_N RMI1_C
Other DBs
NCBI-ProteinID: EDS41799
VectorBase: CPIJ004237
UniProt: B0WAT3
AA seq 618 aa
MIQSETTRAAQVKGRFLREYSIKVVDEWLTGCVTFGLQENPKISNDALFQFAFDQWLLAD
LCEVGVSTLPDVGEEGGGFVTLGGKYAVQLNYLVDISEPCYDQLRNLYNKKLDEADDEIQ
MRKNQAQHVKKKRMLKLELSDGRKTVVGMEHSPIAALSTKIPPGTKMLLMGPIRCINKVL
FLEPKNVRILGGEVDTLLITNAFENVLLRALGKELNPDPKTEYEEVVVVEKNRNANYANI
PTVPMVYSSPTKLKTSSSRQGNDDWEDDMLLGINLEAIEGSAGQKAKPPEQVHTISTLMD
DDDADLEIINLPEEEIMNHQVSSTKTSQPSPKAPPKRAPPVRLPSFDGPDDDIDALEALE
SEIRAEQRNNYEEPPPTPSTAPQLAKRPRIASPAVVSTGSQQPSTSSKNFDDKCTVSALF
DDDNDDSLEAFEIRPKSPAMESDDPLSPRYRFQIEGHSLVTVNQINQLADADRHDRTFVV
FGEVMDVFERVRVSGGQWKLGVQISDRSERMLSVRFHTDVIAGMVGHDGVAMETMKRDRS
EEGLKRLQEILIRFKNNLCELRSFMRVQYDRSGDIPFVTELYEFTAPRQATLKEKVARER
ATAHLLEVLPPDCDIVKR
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgatccaatcggaaacgacccgagcggcccaggtgaagggccggtttttgcgcgagtac
tcgatcaaggtggtggacgagtggttgaccgggtgcgttacgtttggactgcaggaaaat
cctaagatttcgaacgatgcgttgttccagttcgcgtttgaccagtggctgctggcggat
ctgtgcgaggtgggagtttcgacgctgccggatgtcggggaggagggtggtgggtttgtg
acgttgggtgggaagtacgcggtgcagttgaactacttggtggacatttcggaaccgtgc
tatgaccagttgaggaatttgtacaataagaagctggacgaggcggacgacgagattcag
atgaggaagaaccaggctcagcacgtgaagaagaagcggatgttgaagctggagttgagt
gatgggcggaagaccgttgttgggatggagcacagtccgatagcggcgttgagtacgaag
attccgccggggacgaagatgctgttgatgggaccgatccgatgtattaataaggtgttg
ttcttggaaccgaaaaatgttcggatcttgggtggtgaggtggacacgctgttgattacc
aatgcctttgagaatgttctgcttagagcgctagggaaagagttgaatccggatccgaaa
accgagtacgaggaggtggtcgtcgtggagaagaaccgcaacgctaactatgcaaacatt
ccgacggtaccgatggtgtactcgtctcctaccaagctaaagaccagtagcagccggcag
ggcaacgacgattgggaagacgacatgctgcttggcattaatctggaagcgattgaagga
agtgctgggcaaaaggccaaacctcccgagcaggtccacaccatcagcacgctgatggac
gacgacgatgccgacttggagatcatcaaccttcccgaggaagagatcatgaatcaccag
gtctcgtcaacgaaaacgtcgcaaccttctccaaaagcacctcccaagcgagcgccaccg
gttcgactgccgtccttcgacggtcccgacgacgacatcgacgcgttggaagcactcgag
agcgaaatccgagcagagcagcgcaacaactacgaagaacctcccccaacgccgtcaacc
gccccacagctagcgaaacgaccccgaatcgcttccccagcggtcgtttcaacgggcagc
caacaaccttcgacgagcagcaaaaactttgacgacaagtgcaccgtttcggcgctattc
gacgacgacaacgacgacagtcttgaagcgttcgaaatccgccctaaatcgcccgccatg
gaaagtgacgacccgctctcaccccgctatcggttccaaatcgaggggcacagtctcgtg
acggtgaaccagatcaaccagcttgcggacgcggatcgccacgatcgaacgtttgtcgtg
tttggcgaggtgatggacgtgtttgagcgggttcgagtgagcggaggccagtggaagttg
ggcgtgcaaatttcggaccggtcggagcggatgctgtcggtgaggttccacacggacgtg
attgccgggatggtcgggcacgatggggtcgcgatggagacgatgaagcgggaccggagc
gaggaagggttgaagcggttgcaggagattctgattcggttcaaaaacaacctctgcgag
cttcgctcgttcatgcgcgtccagtacgaccgaagcggggacatcccgttcgtaacggaa
ctgtacgagttcaccgcccctcggcaagccaccctgaaggaaaaggtcgcacgcgaaaga
gcaactgcccaccttttggaggttttacctccggactgtgatatcgtcaaaaggtaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019872
Entry
CpipJ_CPIJ019872  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10990  RecQ-mediated genome instability protein 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ019872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ019872
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     CpipJ_CPIJ019872
   FA (Fanconi anemia) pathway
     CpipJ_CPIJ019872
SSDB
Motif
Pfam: RMI1_C
Other DBs
NCBI-ProteinID: EDS32400
VectorBase: CPIJ019872
UniProt: B0XKQ0
AA seq 134 aa
MDVFERVRVSGGQWKLGVQISDRSERMLSVRFHTDVIAGMVGHDGAAMETMKRDRSEEGL
KRLQEILIRFKNNLCELRSFMRVQYDRSGDIPFVTELYEYTAPRQATLKAKVARERSTAH
LLEVLPPDCDIVKR
NT seq 405 nt   +upstreamnt  +downstreamnt
atggacgtgtttgagcgggttcgagtgagcggagggcagtggaagttgggcgtgcagatt
tcggacaggtcggagcgaatgctgtcggtgaggttccacacggacgtgattgccgggatg
gttgggcacgatggggccgcgatggagacgatgaagcgggacaggagcgaggaagggttg
aagcggttgcaggagattctgatccggttcaaaaacaacctctgcgagcttcgctcgttc
atgcgcgtccagtacgatcgcagcggtgacatcccgttcgtaacggaactgtacgagtac
accgccccccggcaagccaccctgaaggcaaaggtcgcacgcgaaaggtcaaccgcccac
ctgctggaggttttacctccggactgtgatatcgtcaaaaggtaa

DBGET integrated database retrieval system