KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004241
Entry
CpipJ_CPIJ004241  CDS       T01079                                 
Name
(GenBank) btf
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ004241
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ004241
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ004241
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ004241
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ004241
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ004241
SSDB
Motif
Pfam: Ssl1 VWA_2 VWA
Other DBs
NCBI-ProteinID: EDS41803
VectorBase: CPIJ004241
UniProt: B0WAT7
AA seq 367 aa
MADDEDPKEYRWETGYEKTWEAIKEDDDGLVEGSIAEIIQKAKRKRQAMKKGFSKLGMMR
HLYVILDCSEAMSVPDLKPTRLLCTLKLLEIFIEEFFDQNPISQLGVIAMKAKRAEKITE
LGGSCRKHIKAVGNLNKLNLTGEPSLQNGLELALKTLKMVPSHASREILVVMGSLTTCDP
TDIHITIDALKSEGIRCSVVSLSAEIRVCKFLCTETGGVYGAVLDDSHFKDQLLQHIDPP
QAGNQQEFSMIKMGFPHGKTEEGKDPPLTMCMCHIDSTDEPSKLTSGGYHCPQCYSNHFP
RRRPGLDCTERTSSCEWYKISERTNKRPTKDSVRAIIVNRTGPAGKCARQCPASSEHRGV
VRDCPLE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcagacgacgaggatccaaaggagtaccgctgggaaaccggctacgagaaaacatgg
gaagcaatcaaggaagatgacgacggtctggtcgagggttcgatcgccgaaatcatccag
aaggccaaacgcaagcggcaagcgatgaaaaagggcttcagcaagctcggcatgatgcgc
cacttgtacgtgattctggactgctcggaggccatgtccgttccggatctgaagccaacg
cggctgctgtgcacgctcaagctgctggagatcttcatcgaggagttcttcgaccagaat
ccgatttcccagcttggggtgatcgctatgaaggccaagcgggcggagaagattacggag
ctgggcggaagttgccggaaacacatcaaggccgttggcaacttgaacaagctgaacctg
accggggaaccgtcgctgcagaacgggctggagttggcattgaagacgctgaagatggtt
ccttcgcacgcgagccgggagattctggtcgtgatgggcagtttgaccacgtgcgatcca
acggacattcacatcacgattgacgcgctcaaatcggaaggaattcgttgttcggtggtt
agtttgtcggcggagattcgcgtctgcaagttcctttgcacggaaaccggaggagtttac
ggggccgtcctagacgattcccatttcaaggatcagttgttgcagcacattgatccgccg
caggccggcaatcagcaggaattctccatgatcaagatgggcttcccgcacggaaaaact
gaagagggaaaagatccgccactaaccatgtgcatgtgccacattgacagcaccgacgaa
ccgtccaaactgacctccggcggatatcactgtccacagtgctacagcaaccattttcct
cggcggcgaccgggcctcgactgtaccgagcgcacctcctcctgcgagtggtacaaaatt
agcgaacgcaccaacaagcgaccgaccaaagactctgttcgggccattatcgttaaccgc
accggaccggccggaaagtgtgcgcgccagtgtcccgcgtccagtgagcatcgaggtgtg
gtgagggattgtccgctggagtag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004242
Entry
CpipJ_CPIJ004242  CDS       T01079                                 
Name
(GenBank) TFIIH basal transcription factor complex p44 subunit
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ004242
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ004242
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ004242
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ004242
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ004242
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ004242
SSDB
Motif
Pfam: Ssl1 C1_4 VWA_2 IBR VWA
Other DBs
NCBI-ProteinID: EDS41804
VectorBase: CPIJ004242
UniProt: B0WAT8
AA seq 411 aa
MADDEDPKEYRWETGYEKTWEAIKEDDDGLVEGSIAEIIQKAKRKRQAMKKGFSKLGMMR
HLYVILDCSEAMSVPDLKPTRLLCTLKLLEIFIEEFFDQNPISQLGVIAMKAKRAEKITE
LGGSCRKHIKAVGNLNKLNLTGEPSLQNGLELALKTLKMVPSHASREILVVMGSLTTCDP
TDIHITIDALKSEGIRCSVVSLSAEIRVCKFLCTETGGVYGAVLDDSHFKDQLLQHIDPP
QAGNQQEFSMIKMGFPHGKTEEGKDPPLTMCMCHIDSTDEPSKLTSGGYHCPQCYSKYCE
LPVECTACGLTLASAPHLARSYHHLFPVPHYQELPFQQQATNCYGCQKLFGETTDKTIYQ
CATCRQFFCIDCDIFVHETMHSCVGCTTIPASVQALHARKPVPPPHSMSLL
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcagacgacgaggatccaaaggagtaccgctgggaaaccggctacgagaaaacatgg
gaagcaatcaaggaagatgacgacggtctggtcgagggttcgatcgccgaaatcatccag
aaggccaaacgcaagcggcaagcgatgaaaaagggcttcagcaagctcggcatgatgcgc
cacttgtacgtgattctggactgctcggaggccatgtccgttccggatctgaagccaacg
cggctgctgtgcacgctcaagctgctggagatcttcatcgaggagttcttcgaccagaat
ccgatttcccagcttggggtgatcgctatgaaggccaagcgggcggagaagattacggag
ctgggcggaagttgccggaaacacatcaaggccgttggcaacttgaacaagctgaacctg
accggggaaccgtcgctgcagaacgggctggagttggcattgaagacgctgaagatggtt
ccttcgcacgcgagccgggagattctggtcgtgatgggcagtttgaccacgtgcgatcca
acggacattcacatcacgattgacgcgctcaaatcggaaggaattcgttgttcggtggtt
agtttgtcggcggagattcgcgtctgcaagttcctttgcacggaaaccggaggagtttac
ggggccgtcctagacgattcccatttcaaggatcagttgttgcagcacattgatccgccg
caggccggcaatcagcaggaattctccatgatcaagatgggcttcccgcacggaaaaact
gaagagggaaaagatccgccactaaccatgtgcatgtgccacattgacagcaccgacgaa
ccgtccaaactgacctccggcggatatcactgtccacagtgctacagcaagtactgcgaa
cttccggtggaatgcacggcctgcggtctgacactagcctccgcaccgcatctggcccgc
tcgtaccatcatctgttcccagtgccccactaccaggaactcccgttccagcagcaagcc
accaattgctacggctgtcagaaactgttcggtgagaccaccgataaaaccatttaccag
tgcgccacctgtcggcagttcttctgcatcgactgcgatatcttcgtgcacgagaccatg
cactcgtgcgtgggctgtacgacgattccggcttcggtgcaggcgctgcacgcccggaag
ccggttccgccgccgcacagtatgtcgttgttgtaa

DBGET integrated database retrieval system