KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004313
Entry
CpipJ_CPIJ004313  CDS       T01079                                 
Name
(GenBank) mei-9
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ004313
   03460 Fanconi anemia pathway
    CpipJ_CPIJ004313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ004313
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ004313
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     CpipJ_CPIJ004313
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    CpipJ_CPIJ004313
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     CpipJ_CPIJ004313
SSDB
Motif
Pfam: ERCC4 SAM_KSR1
Other DBs
NCBI-ProteinID: EDS42136
VectorBase: CPIJ004313
UniProt: B0WB71
AA seq 955 aa
MLEYERQMFFDVLHSDGLTVCAKGITYEKVLQNLLKIFCDSTTLVLVVNCSDYEEKLLTS
QLDSQHVHESSTNATERERVYLLGGIQFMSTRILVVDLLKGRIPIELITGIIVVKAHEII
ESCQEAFALRLYRQKNKTGFIKAFSRNVEAFTYGYGHVEKVMRNLFVRELFIWPRFHATI
QKSLKPYEPVVVELQIPMSQNMILLQANILDIMNYLVKNIKSLNRLVELQEITVENCVTK
QFHKILQSQLDSIWHQLSSQTKLIVADLKVLRSLMITTLYHDAVTLYAVMKKYRSTEYAL
SNSGWTILDSAEKIFNICKERVFNQNDEFDPEQCPKWKSLSEVLRKEIPTDVKETAGKIR
KKEERQKYLRQQVKVLVLCQDARTCYQLNQYLTQGPEKYLFHMAMKNDVTVAKLAESYRH
INREDEPNPFRIQQVQVKPKEAVLKESTSVEGSTSKTGFLKERIAKRRAEAAKKEAEEEE
ARKREEEEDRKKVSEMEAELLAKEESEEYHCFRDSYILTMSQKGDANRTMTDDGELDDLC
DITQLENGEFESFAEMEQLDMTRIEKESSRPIVFIQTFKSEINGIASLDRTLEEIKPRYI
VMYHSNVTAIRQIEVFEARQQRTELTRVRVFVIIHSKTVEEQSYLTSLRREKQAFELLID
TKRTMVVPEYQDGKSEDAITMLQKAQEVSSRQAGGQAADEQLPVTPRIIVDMREFRSDLP
CLIHRRGIEVIGDYILSPEICVERKSISDLIGSLNSGRLYNQCVQMTRFYAKPMLLIEFD
QNKPFHLQRNFVVSGDAGSSNADIMQKLQLLTMHFPKLKLVWSPSPYATAQLFEELKQGK
LEPDPDVAALVGSDEAGGPSEMENIAESSNPNIHDFLIKLPGINSKNIGKVMRKCKNLKE
LLQKSQEELRELLGTELHAKMLWEILHVAHKPVLGEAAEKPSASKFKRGFGKRNF
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgctggagtacgagcggcagatgtttttcgacgtgctgcactcggacgggctgaccgtg
tgcgccaagggaatcacgtatgaaaaggtattgcagaatctgttgaagattttctgcgat
tcgacgacgctggtgttggtcgtaaattgctccgattacgaggagaagttgctcacgtcg
cagttggacagccagcacgttcacgagtcctcgacgaatgccacggaacgcgaacgggtt
tatctgcttggggggattcagtttatgagtacgcggattttggtggttgatttgctaaag
ggtaggattccgattgagctaatcactgggataattgtggtgaaggctcatgagattata
gagtcgtgccaggaagctttcgcgcttcgattgtataggcagaagaataaaacagggttc
atcaaggcgttttcgagaaacgttgaagcgtttacttacggatacggccacgtggagaag
gtcatgcgcaacctgtttgtgagggagttattcatttggccacggtttcacgcgacgata
caaaagtccctgaaaccgtacgagccggtcgtcgtggagctgcagataccgatgagccag
aacatgattcttctgcaagccaacattctggacattatgaattacctggtgaagaacatc
aaaagtttgaatcgtctcgtggaactgcaggagattacagtggagaattgcgtcaccaaa
cagtttcacaaaattctgcagtcccagctggacagcatttggcaccagctcagctcgcag
accaagctgatcgtggcagatttgaaggtgttgcgtagtttgatgataacaactctgtac
cacgatgccgtcacgttgtacgctgtaatgaagaaatatcgctcgactgagtacgcgctt
agcaattccggctggaccattctagattctgcggaaaagattttcaacatttgcaaggag
agggtcttcaaccagaatgacgaattcgacccggagcaatgccccaagtggaagtccttg
tcggaagtactgcgcaaggaaattccaaccgacgtgaaggaaacggccggcaagatccgc
aaaaaggaagagcgccaaaagtatctgcgccagcaggtgaaggtgctggtgctgtgccag
gacgcgcgaacctgctaccagctgaaccagtatctcacgcaaggccccgaaaaatatctc
tttcacatggcgatgaagaacgacgtgacggtggcgaagctggccgaaagctaccggcac
atcaaccgggaggatgagccgaacccgttccggattcagcaggttcaggtcaaaccgaag
gaagctgtgctgaaggaatcgacgtcagtggaggggtcgacgagcaagactggtttcctg
aaggaacggatcgccaaacgacgagcagaggcggccaagaaggaggccgaagaggaggaa
gctcgcaaacgggaagaggaagaagatcggaaaaaggtttccgaaatggaggcggaattg
cttgcgaaagaggagagtgaagagtaccattgcttccgggattcgtacatcctaacgatg
tctcagaaaggagacgcgaatcgcaccatgacggacgacggagaattggacgatctatgc
gacatcacccagttggagaacggcgaatttgagtcgtttgccgagatggaacagctggac
atgaccagaattgaaaaggaaagcagccgaccaatcgtattcattcaaacgttcaagagc
gaaatcaacgggatcgcatcactggaccgaacgctggaggagatcaagccccgttacatc
gtcatgtaccacagcaacgtaacggcgatccgacagattgaagtgttcgaagctcgccag
cagcgaacggaactgaccagagttcgcgtgtttgtgataattcactcgaaaaccgttgaa
gaacagtcctatctaacttcgctccgacgagagaagcaggccttcgaactgttgatcgac
accaagcgaacaatggtcgttccggagtaccaggacggcaagtccgaggacgccatcacg
atgctgcagaaggcacaggaagtttcctcccggcaagccggaggccaagccgccgacgaa
cagctccccgtaacgccacgaatcatcgtggacatgcgcgagttccggtccgatttgccg
tgcctcatccatcggcgtggaatcgaagtcatcggtgactacatcctttccccagaaatt
tgcgtcgagcgcaaatcaatttccgacctgatcggttcgctcaactcgggccgcctctac
aaccagtgcgtccagatgacgcgcttctacgccaagcccatgctgctgatcgagttcgac
cagaacaaaccgttccacctgcagcgcaactttgtcgtgtcgggcgacgccggctcctcg
aacgcggacattatgcaaaagctgcagctgctgacgatgcactttccgaagctgaagctc
gtctggtcgccgagtccgtacgcgacggcgcagctctttgaagagttgaagcagggcaag
ctggagcccgatccggatgtggcggcgctcgtgggctccgatgaagctggtgggccgagc
gagatggagaacattgccgagagttcgaacccgaacattcacgactttctcatcaagctg
ccggggattaactccaagaacatcggaaaagttatgcgaaagtgtaaaaatctgaaggaa
ttgctccagaaatcgcaggaagaactgcgcgagctgctgggcacggaactgcacgcgaaa
atgctgtgggaaattttgcacgtggcacacaaaccggtgctgggagaagcggccgagaag
ccgtcggcgtccaagtttaagcggggctttggaaagaggaatttttaa

DBGET integrated database retrieval system