KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004855
Entry
CpipJ_CPIJ004855  CDS       T01079                                 
Name
(GenBank) cyclin-H
  KO
K06634  cyclin H
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ004855
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ004855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ004855
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ004855
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ004855
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ004855
SSDB
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB Cyclin_C Pox_A_type_inc RB_B GspL_C
Other DBs
NCBI-ProteinID: EDS43796
VectorBase: CPIJ004855
UniProt: B0WCS0
AA seq 333 aa
MYPQSSQKKFWSFKTEQELQERRLLQNYNFIARHGAAMSEEQKAAFFLSADEERLLLKQY
ELQLKEFCKRFEPPMPKYVVGTAFHYFKRFYLNNSAMDYHPKEILATCVYLSCKVEEFNV
SINQFVANIKGDRSKAMDIILSNELLLMQELNYYLTIHNPFRPVEGFLIDIKTRCHMNNP
DRLRPGIEDFIDKTFLTNAILMYAPSQIALAAVLHAASKEQENLDSYVTESLFGAAEDKL
PVLIEAVKRIRSMVRTIELPQKDKVRQLEKKLEKCRNQENNPDSQIYKQRMKKMYEDEDE
AELMATSYHMNASDVSLEVSHLNSSNPANMSIE
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtacccccaaagttcccagaaaaagttctggtcgttcaaaactgagcaggaactgcag
gagcgccggctgctgcaaaattacaactttatcgcgcggcatggtgccgcaatgagtgag
gagcaaaaggcggccttctttctgtccgccgacgaggagcgacttctgctgaagcagtac
gagctgcagctaaaagagttctgcaagcggttcgagcctccgatgccaaagtacgtcgtt
ggaaccgcctttcactacttcaagcggttctacctcaacaactctgcgatggactatcac
ccgaaggagatcctagccacgtgcgtttatctgtcctgcaaggtggaggagttcaacgtg
tcgatcaatcaatttgtggccaacattaagggtgaccgcagcaaggccatggacatcatt
ctgtcgaacgaactgctactgatgcaggagctgaactattacctcaccatacacaatcca
ttccggccagtcgagggattcctgatagatattaagacccgctgccatatgaacaacccg
gatcggctgcgccctgggatcgaggatttcatagacaaaaccttccttacgaacgccatc
ctgatgtacgccccctcgcagatcgccctggcggcggttctgcacgcggccagcaaggag
caggagaacctggacagctacgtcaccgagtcgctgttcggggcggccgaggacaagctg
ccggtgctgatcgaggcggtcaagcggatacggtcgatggtgcgcaccatcgagctgccc
cagaaggacaaggtgcgccagctggagaagaagctggaaaagtgccgcaaccaggagaac
aacccggacagtcagatctacaagcagcgaatgaagaagatgtacgaagacgaggacgag
gcggaactgatggcgacgtcctaccacatgaacgcgtccgatgtgagcttagaagtgtcc
cacctgaacagtagcaatccggcgaacatgtcaatcgagtaa

DBGET integrated database retrieval system