KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006288
Entry
CpipJ_CPIJ006288  CDS       T01079                                 
Name
(GenBank) DNA topoisomerase 3-alpha
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ006288
   03460 Fanconi anemia pathway
    CpipJ_CPIJ006288
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ006288
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ006288
Enzymes [BR:cqu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     CpipJ_CPIJ006288
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Topoisomerases
   CpipJ_CPIJ006288
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     CpipJ_CPIJ006288
   FA (Fanconi anemia) pathway
     CpipJ_CPIJ006288
SSDB
Motif
Pfam: Topoisom_bac zf-GRF Toprim zf-C4_Topoisom zf-C2H2_10
Other DBs
NCBI-ProteinID: EDS26858
VectorBase: CPIJ006288
UniProt: B0WGC0
AA seq 992 aa
MKYLNVAEKNDAAKNIAALLSRGASQRREGYSPYNKIYEFDYNLRGQQVKMVMTSVSGHL
LNFEFLPSFRGWHSCNPEQLFDAPVRKGCTESAEKIKRTLEREIRGCGALVIWTDCDREG
ENIGFEIIEVCRAVKPQIKVLRAKFSEITAASIKRAVDNLAAPDELQSEAVNVRSELDLR
IGAAFTRFQTLRLQNVFPDKISNSLVSYGSCQIPTLGFVAQRYKEIENFIPQAFWKIKLN
HTIGELTVEFNWSRNRLFDKQCCEAYLMLCQSEQMAKIVSVTNKPKSKWRPTPLDTVELE
KLGSRKLKLNAKTTMTIAEKLYTQGIISYPRTETNMFTHDMKLAPLVEMQAGHPEWGDFA
QKVMQWGPNPRNGKKSDQAHPPIHPTKFVTNLSGDEKRVYELVVRHFLACVSKDAVGAET
IVNAVLAEEEFTASGLCILERNYLEVYPYDRWNSKEIHAYQMGNTFEPTELGLHEGSTTA
PNMLTEADLIALMEKHGIGTDATHAEHINTIKERGYIGEADRGFLVPGTLGMGLVEGYES
MELPLAQPKLRAGLEEDLKRICEGQRDPKVVLQEQIQKYKEAYRVITEKARALDQAMGQR
LQQTPRDAPTNQFNAAGPSSIQEVCKCPKCSQMMCLKTKKDNSGYYLGCLGFPDCKNSVW
FDDNIKEASATTEVCSKCATGNKKLEVKFKFSRYYAMLNHTNNESYKTCIVCDDKFRETL
GINDSNVKQFRSNGIRTDVTIPPRGTAPPNNAPRPPSQNPFSDRSSGRGSGTSTTSRSWG
SNNDDDDDRRGGGGGAISTGRTNNTNSAAGGSSGWGSGNLSFNNSSTTTTTNTWNRNPAP
PAPARGPPRSGNDDEVLCRCNLPAKSLTVRKDGPNQGRPFYACPKPKDEQCQFFQWADEP
PPSAPGTGGGAGGGYSWGQKRPAPPSDGGGFAGGSRAAGGSSDWGRSSGAGSSGSRGGSK
TGDRARATRKCGFCRQEGHTKAKCPQRENADY
NT seq 2979 nt   +upstreamnt  +downstreamnt
atgaagtatctgaacgtagcggagaaaaacgatgcggccaagaatattgcggccctgctg
tcgcggggtgcgtcccagcggcgcgagggatactctccgtacaacaagatctacgagttc
gattacaacctgcgcggtcagcaggtcaagatggtcatgacgtcggtttcggggcacttg
ttgaactttgagtttctgccgtcgttccgggggtggcacagctgcaacccggagcagctg
tttgacgcgccggtccgaaagggttgtacggagagtgcggagaagattaagcggacgctg
gagcgggagattcggggctgcggggcgttggtcatctggacggattgcgatcgagagggg
gagaacattgggtttgagattattgaggtgtgtcgggcggtgaagccgcagattaaggtg
ttgagggcaaagttttccgagattacggcagcgtcgattaagcgtgcggtggacaatttg
gcggcgccggatgagctgcagagcgaggcggtgaatgtgaggagcgagttggatttgcgg
ataggggcggcctttacgcggtttcagacgctgcggctgcagaacgtgtttccggacaag
atctcgaacagtttggtgtcgtacgggagttgccagattccgacgttggggtttgtcgcg
cagcggtacaaggagatcgagaactttattccgcaggcgttttggaagattaagctgaat
cataccatcggggagctcacggtggagttcaactggtcccggaaccggctgttcgacaag
cagtgctgcgaggcgtacctgatgctgtgtcagtcggagcagatggccaaaatcgtgagt
gtaacgaacaaacccaagagcaagtggcgtccgacgccactggacacggtcgagctggag
aagctgggttcgcggaagctgaagctcaacgccaagacgacgatgacgatcgcggagaag
ctgtacacgcagggtataattagctatccgcgtacggagacaaacatgtttacgcacgac
atgaagttggctccgctggtggaaatgcaggccggtcatcccgagtggggagactttgcc
cagaaggtgatgcagtggggaccgaatccgcggaacgggaagaaatctgaccaggcccat
cctccgatccatccgaccaaattcgtgacgaatttgagtggggatgagaagagggtatac
gagcttgtggttcgacactttttggcctgcgtgagcaaggacgccgtcggtgcggaaacc
atcgtaaatgcggtcctggcggaagaagagttcacagcttccgggctgtgcatccttgag
cggaactatctggaggtttatccgtacgatcgatggaactcgaaggaaattcatgcgtac
cagatggggaacacgtttgagccgaccgagctgggattgcacgaaggctcgacgacggcg
ccgaacatgctgacggaggcggacttgattgccctcatggaaaagcacggcatcgggacg
gacgcaacgcacgcggaacacatcaacacgatcaaggaacgcggctacatcggcgaggct
gaccgcggatttctcgtgcctggaacgctcggcatgggcctcgtcgagggctacgaatcg
atggaacttccgctggctcaacccaagcttcgagccggtctcgaagaggacctcaagcgg
atttgcgaaggacaaagagatcctaaagttgtcctccaagagcagatccaaaagtacaaa
gaagcgtaccgggtcatcacggaaaaggcccgagcgttggaccaagccatgggtcagcga
ctccaacaaaccccgcgtgacgcccccaccaaccagttcaacgccgcgggaccttcttcc
atccaagaggtttgcaagtgtccaaagtgttcccaaatgatgtgcctcaagacgaagaag
gacaacagcggctactacctcggctgtctcggattccccgactgcaaaaattcagtctgg
ttcgacgacaacatcaaggaagcttccgcgaccaccgaagtctgctccaaatgtgccacc
ggcaacaaaaagctcgaggtcaagttcaaattcagccgatactacgccatgctcaaccac
accaacaacgaatcctacaaaacgtgcatcgtctgcgacgacaagttccgagaaacgctc
ggaatcaacgacagcaacgtcaagcagttccgatcgaacggcatccggacggacgtgaca
atccctccccgaggaaccgccccacccaacaacgcccctcgcccaccatcccaaaacccc
ttctccgaccgctccagtggccgcggaagcggaacaagcacgaccagccgaagctggggc
tcaaacaacgacgacgacgacgatcgccgcggtggcggcggaggcgccatctccaccggt
cgcaccaacaatacaaactccgccgcaggcggcagcagtggctggggcagcggcaaccta
tccttcaataactccagcaccacaaccaccaccaacacgtggaaccgtaacccggcacca
cctgcacccgcccgtggcccaccgcgaagcggcaacgacgacgaggtgctctgtcggtgc
aatttgcccgccaaatcgctcaccgtgcggaaggacggtcccaaccagggccgaccgttc
tacgcctgtcccaagcccaaggacgagcagtgtcagtttttccagtgggcggatgagccg
ccgccgagcgcaccgggaactggtggtggagcgggaggagggtacagttggggtcagaaa
aggccagcgccgccgtcggatgggggcggctttgcggggggaagtcgtgcggcgggagga
tcgtccgattggggcagatcgagtggggctggttccagcggcagcaggggtggatcgaaa
acgggagatagggcgagggcgaccaggaagtgcggcttttgtcggcaggaggggcacacg
aaggccaagtgtcctcagagagaaaatgcggattattag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009756
Entry
CpipJ_CPIJ009756  CDS       T01079                                 
Name
(GenBank) DNA topoisomerase 3-beta
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ009756
   03460 Fanconi anemia pathway
    CpipJ_CPIJ009756
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ009756
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ009756
Enzymes [BR:cqu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     CpipJ_CPIJ009756
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Topoisomerases
   CpipJ_CPIJ009756
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     CpipJ_CPIJ009756
   FA (Fanconi anemia) pathway
     CpipJ_CPIJ009756
SSDB
Motif
Pfam: Topoisom_bac Toprim
Other DBs
NCBI-ProteinID: EDS33017
VectorBase: CPIJ009756
UniProt: B0WQT7
AA seq 855 aa
MKCALMVAEKPSLAQSLAQILSNGKCSSRKGSNNACSVHEWVGNFHGQQTRFKMTSVCGH
IMGLEFVGKYNSWDKVDPADLFTCATEKKESTPNLRMPAFLSHEAKGCDYLVLWLDCDKE
GENICFEVMASVANTIPNVYSNRVTYRAKFSAITEKDIKYAMENLIQPNENEAKSVDARQ
ELDLRIGCAFTRFQTKFFQGKYADLDASLISYGPCQTPTLTLCVQRHDEIQTFKPESFWY
VQVTVGENPEIKLDWSRVRIFEKEVACMFLNKVKDHKEAIVENVSSKEAFKGRPQALNTV
ELMRAASAGLGIGPHSAMQIAEKLYTRGYISYPRTETTQYPTNFDLVGVVKLLQHSSEFG
DEAKSILHDMNSPRKGNDAGDHPPITPMKLASRNELDGGDTFRVYDYICRHFLATVSRDL
KYRQTSTKFKIGSEHFSNTSNVLIDPGYTKVMTWQAFAKNELVVPFIVNEKVKINDVRLV
ESQTGPPDYLTESELISLMEKHGIGTDASIPVHINNICQRNYVAIGGGRTLTPTNLGIVL
VHGYQKIDPELVLPTMRSAVEQQLSLIAHGSADYRSVLKHAVEIFRLKFLYFVQNISNMD
ILFEATFSSLSSSGKALSRCGKCRRYMKYIQSKPSRLHCSTCDETYTMPVKGVVRVYREL
KCPLDDFELLAWSNGAKGKSYPLCPYCYNHPPFRDMAKNSGCNSCPHPTCAHSLTLLGVS
SCIECDRGILVLDCTSSPKWKLVCNFCDVIINCFDDAVKVNVEAESCDECGAQQVTAIYK
TEKTPFKDDITEKKGCIFCFPDFVPLVEKHKAVEMRRGQGGRGRGRSLCGRGGKSGRGRN
KPPKDKMAQLAAYLV
NT seq 2568 nt   +upstreamnt  +downstreamnt
atgaagtgcgcattgatggttgctgaaaaaccgagtttggctcaaagcttggcccagatc
ctgagcaatggaaagtgttcgtcaaggaaaggttccaacaatgcctgctctgtgcatgag
tgggttggaaactttcatggccagcagacgaggttcaagatgacatcggtgtgtgggcat
ataatgggacttgaatttgtgggcaaatacaattcgtgggataaggtagatccggcggat
ctattcacatgtgcaaccgagaaaaaggagtcaacgcctaatctgagaatgccggctttt
ctaagccatgaggcaaaagggtgtgactatctggttctgtggctagattgcgacaaagaa
ggagaaaatatttgcttcgaagtaatggcatcggtagcgaacaccattccgaatgtttat
tcgaaccgggtcacgtaccgagcaaaattctccgccattaccgaaaaagacatcaaatat
gccatggaaaatctcattcaacccaatgaaaacgaagccaagtcggttgatgcccgacag
gagctggaccttcgcatcgggtgtgcctttacgcgcttccaaaccaagttttttcagggc
aaatatgccgatctcgatgcatctttaatcagctacggcccttgccagaccccgacacta
acattgtgcgttcaacgtcacgacgagatccaaacatttaagccggaaagcttctggtat
gtgcaggttaccgttggagaaaatcccgagataaaactggactggtcacgggtaagaatc
ttcgaaaaggaggttgcctgcatgtttttaaacaaagtcaaggatcacaaagaagcaatc
gtagaaaatgtatcatccaaggaagcattcaaaggcagaccgcaggccctcaatacggta
gagctgatgagagctgccagcgcagggctcggcattggaccccattctgctatgcaaatt
gctgaaaaactctacacccgcggctacataagttatcctcgaaccgaaacaactcaatat
ccaacgaactttgatctagttggcgtagtcaaactactgcaacactcgtctgagtttggt
gatgaagcaaaaagcattcttcacgacatgaatagtccacggaagggcaatgacgccgga
gatcatccacccatcacgccaatgaagctggcatcacgcaacgagctggatggtggagat
acatttagggtttatgactacatatgtcggcattttttggccactgtgtcacgtgatttg
aaatatcgccagacgagcactaaatttaaaatcggaagcgagcactttagcaacacctct
aacgtgttgattgacccaggttacacgaaggtgatgacttggcaagctttcgcaaagaac
gaactggttgtgccatttatcgtaaacgaaaaggttaaaataaacgacgtccgcctcgta
gaaagccaaacgggacccccggattacttgaccgagtcggaactcatctctttgatggag
aaacatggcatcggaaccgatgctagtattccagtccacataaataacatatgccagcga
aactatgtagccattggtggcggacgaactctaaccccgacaaacttaggcattgtgcta
gttcacggatatcagaagatcgatcccgagctagtgctgcccacaatgcgttcagccgtt
gagcaacagttgagcttaattgcacatggttcagccgattatcgttccgtcctcaagcac
gcggtggaaatttttcgcctaaaatttctatactttgtgcaaaatatcagcaacatggac
attctattcgaagccaccttttcatcgctcagctcgtcgggaaaagctctgtcacgctgt
ggcaagtgccgacgatacatgaaatacattcaatcgaagccctctcgtctgcactgctcg
acgtgtgacgaaacgtacaccatgccggtaaaaggagtggtacgagtttaccgcgaatta
aagtgtccgctcgatgatttcgaattgctcgcttggtccaatggtgccaaaggcaagagc
tatccattgtgtccctactgttacaaccatccccccttcagggatatggcgaagaattcc
ggctgcaacagctgtccccatccgacgtgtgctcactcgttaaccttacttggtgtctcc
agttgcattgagtgtgaccgcggcatcctcgtgctggattgcaccagttctccaaagtgg
aaactcgtgtgtaacttttgcgacgttattatcaactgtttcgacgatgctgtaaaggtc
aacgttgaagccgaatcttgtgacgagtgtggtgcccagcaagttacggctatttataaa
accgaaaaaacgccgttcaaagacgacattactgagaaaaagggatgcatattttgcttt
cctgattttgttcctctggtggagaagcacaaagctgtcgaaatgcgccgtggccaaggt
ggtcgaggccgtggccgtagcttgtgtggtcgcggtggtaagagcggaagaggacgcaac
aagcctccgaaggataagatggcccaactagcggcctatctcgtgtag

DBGET integrated database retrieval system