KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006481
Entry
CpipJ_CPIJ006481  CDS       T01079                                 
Name
(GenBank) TFIIH basal transcription factor complex helicase XPB subunit
  KO
K10843  DNA excision repair protein ERCC-3 [EC:5.6.2.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ006481
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ006481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ006481
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ006481
Enzymes [BR:cqu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     CpipJ_CPIJ006481
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ006481
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ006481
SSDB
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 ResIII Helicase_C SNF2-rel_dom AAA_34 DEAD TniB
Other DBs
NCBI-ProteinID: EDS28102
VectorBase: CPIJ006481
UniProt: B0WI20
AA seq 810 aa
MGPPKKSSKKDRPSSSSAAGSSTGGFVENKWKKRRPEDDAYSSLANDDDDSSMDGAGGEF
VPGAASKNAEKNDDGIGEDEYGAKDYRSQMQLKPDNASRPLWVAPNGHIFLESFSPVYKH
AHDFLIAISEPVCRPEHIHEYKLTAYSLYAAVSVGLQTHDIIEYLKRLSKCTVPDGIQEF
IRLCTLSYGKVKLVLKHNKYFVESPHPEVLQKLLKDPVIQSCRLRRTNEEGEGFITQTME
KKGITAFGTTKIGPTTVVPGAEAEKPAEPENAAPVPDDITNFYDKMDNEEEEEEANFNTV
SFEVNQEKIEVLQKRCIEIEFPLLAEYDFRNDTINADINIDLKPAAVLRPYQEKSLRKMF
GNGRARSGVIVLPCGAGKSLVGVTACCTVRKRALVLCNSGVSVEQWKQQFKMWSTADDSM
ICRFTSEAKDKPMGCGILVTTYSMITHTQKRSWEAEQTMRWLQEQEWGIMVLDEVHTIPA
KMFRRVLTIVQSHCKLGLTATLLREDDKIADLNFLIGPKLYEANWLELQKRGYIARVQCA
EVWCPMAPEFYREYLVTKTSKKMLLYVMNPQKFRACQYLIRYHEKRGDKTIVFSDNVFAL
KHYAIKMNKPYIYGPTSQNERIQILQNFKFNPKVNTIFVSKVADTSFDLPEANVLIQISS
HGGSRRQEAQRLGRILRAKKGAIAEEYNAFFYTLVSQDTLEMGYSRKRQRFLVNQGYSYK
VITHLAGMESDPDLFYKTREEQGQLLQQVLSASDMDCEDERIPGEGGAPRPGGSKRTGGL
SSMSGADDAVYMEFRKKKEHLHPLFKKFRG
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgggtccgccgaagaaatcttcgaagaaggaccgcccttcgagcagctcggccgcgggt
tccagcacgggtggcttcgtggaaaacaagtggaagaagcgccgtccggaagacgatgcg
tactcgtcgctggcgaacgatgatgatgacagcagcatggacggggccgggggtgaattt
gtgccgggagcggccagcaagaacgcggagaaaaacgacgacggaatcggggaggacgag
tacggggcgaaggactaccggtcgcagatgcagctgaagccggataatgcgtcgcggccg
ctctgggtcgcaccgaatgggcacatatttctggagtcgttttcgccggtgtacaagcac
gcgcacgattttttgattgcgatttccgagccggtttgtcgtccggaacacatccacgag
tacaagctgacggcgtacagtctgtacgcggccgtttcggtgggactgcaaacgcacgat
attattgagtatctgaagcggctcagcaagtgtacggttcctgacggaatccaggagttt
atccggctgtgtacgctatcgtacggcaaggtcaagctggtgctgaagcacaacaagtat
tttgtggagagcccccatccggaggtgctgcagaagctgctgaaggatccggtgattcag
tcgtgccggttgcggcgaaccaacgaggaaggggagggattcatcacgcaaaccatggaa
aagaagggaattacggcgtttgggacgaccaagattgggccgacgacggtggtgcccggt
gcggaggcggagaaaccggccgagccggaaaatgctgctccggttccggacgacattacg
aacttttacgacaaaatggacaacgaggaagaggaggaagaggcgaatttcaacaccgtt
tcgtttgaggtgaaccaggagaagattgaggtgctgcagaagcgttgcatcgagattgag
ttcccgctgttggcagagtacgatttccgaaacgatacgattaacgcggacattaacatc
gatttgaagccggcagctgtgctgcgcccgtatcaagagaagagtctgcggaagatgttc
ggaaatggacgtgcccgttcgggagttatagtgttgccttgcggtgctggtaaatctctg
gttggggttacggcctgctgtacggtgcgcaagcgtgccctggttctgtgcaacagcgga
gtttcggtggaacagtggaagcagcagttcaagatgtggtccaccgccgatgacagcatg
atctgtcgattcacctcggaagccaaggacaaaccgatgggttgcggcatcctggtgacg
acgtactccatgataacgcacacccagaagcgttcctgggaggcggaacaaacgatgcgc
tggctgcaggagcaagagtggggcataatggtcctcgacgaggtgcacaccattccggcc
aagatgttccgtcgagtgttgacgatcgtacagtcgcactgtaagctcggactgaccgcc
actttgcttcgtgaggacgacaagattgccgacctgaacttcctcattgggccgaagctg
tacgaagccaactggttggagctgcagaagcgaggctacatcgcccgagttcagtgcgcc
gaagtgtggtgtccgatggctccggagttttaccgcgaatatctcgtcacgaagacgtcc
aaaaagatgctgctgtacgtaatgaacccgcaaaagttccgcgcctgtcagtatctgatc
cgctaccacgagaaacgtggcgacaaaacgatcgtcttcagcgataacgtgttcgccctc
aagcactacgccatcaagatgaacaaaccgtacatctacggccccacctctcagaacgag
cgaatccagatcctgcagaacttcaagttcaaccccaaagtgaacaccatcttcgtgagt
aaggtcgccgacaccagtttcgatttgcccgaagcgaacgtcctcatccagatctcctcg
cacggaggttcccgtcgtcaggaggcgcaacgtctcggccgtattctgcgcgccaaaaag
ggcgccatcgcggaagagtacaacgcgttcttctacacgctcgtctcgcaggacacactc
gagatgggctactcgcgcaagcgtcagcggttcctggtgaaccagggctacagctacaag
gtgattacgcacctggccggcatggagagtgatccggatttgttctacaagacgcgcgag
gagcagggccagctgctgcagcaggttctgtcggcgtccgacatggactgcgaggacgag
cgcattccgggcgaggggggagcgccgaggccgggcgggtcgaagcgaaccggtgggctc
agctcgatgtccggcgcggacgacgcggtgtacatggagttcaggaagaagaaggagcat
ctgcatccgctgtttaagaagtttaggggataa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016774
Entry
CpipJ_CPIJ016774  CDS       T01079                                 
Name
(GenBank) TFIIH basal transcription factor complex helicase XPB subunit
  KO
K10843  DNA excision repair protein ERCC-3 [EC:5.6.2.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ016774
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ016774
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ016774
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ016774
Enzymes [BR:cqu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     CpipJ_CPIJ016774
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ016774
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ016774
SSDB
Motif
Pfam: ERCC3_RAD25_C ResIII Helicase_C SNF2-rel_dom AAA_34 DEAD Oberon_cc TniB
Other DBs
NCBI-ProteinID: EDS45506
VectorBase: CPIJ016774
UniProt: B0XDJ8
AA seq 544 aa
MPVRSENGRAGNAAPVPDDITNFYDKMDNEEEEEEANFNTEKIEVLQKRCIEIEFPLLAE
YDFRNDTINADINIDLKPAAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAC
CTVRKRALVLCNSGVSVEQWKQQFKMWSTADDSMICRFTSEAKDKPMGCGILVTTYSMIT
HTQKRSWEAEQTMRWLQEQEWGIMVLDEVHTIPAKMFRRVLTIVQSHCKLGLTATLLRED
DKIADLNFLIGPKLYEANWLELQKRGYIARVQCAEVWCPMAPEFYREYLVTKTSKKMLLY
VMNPQKFRACQYLIRYHEKRGDKTIVFSDNVFALKHYAIKMNKPYIYGPTSQNERIQILQ
NFKFNPKVNTIFVSKVADTSFDLPEANVLIQISSHGGSRRQEAQRLGRILRAKKGAIAEE
YNAFFYTLVSQDTLEMGYSRKRQRFLVNQGYSYKVITHLAGMESDPDLFYKTREEQGQLL
QQVLSASDMDCEDERIPGEGGAPRPGGSKRTGGLSSMSGADDAVYMEFRKKKEHLHPLFK
KFRG
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgcccgtgcggagcgagaacggccgagccggaaatgctgctccggttccggacgacatt
acgaacttttacgacaaaatggacaacgaggaagaggaggaagaggcgaatttcaacacc
gagaagattgaggtgctgcagaagcgttgcatcgagattgagttcccgctgttggcagag
tacgatttccgaaacgatacgattaacgcggacattaacatcgatttgaagccggcagct
gtgctgcgtccgtatcaagagaagagtctgcggaagatgttcggaaatggacgtgcccgt
tcgggagttatagtgttgccttgcggtgctggtaaatctctggttggggttacggcctgt
tgtacggtgcgcaagcgtgccctggttctgtgcaacagcggagtttcggtggaacagtgg
aagcagcagttcaagatgtggtccaccgccgatgacagcatgatctgtcgattcacctcg
gaagccaaggacaaaccgatgggttgcggcatcctggtgacaacgtactccatgattacg
cacacccagaagcgttcctgggaggcggaacaaacgatgcgctggctgcaggagcaggag
tggggcataatggtcctcgatgaggtgcacaccattccggccaagatgttccgtcgagtg
ttgacgatcgtgcagtcgcactgtaagctcggactgaccgccactctgcttcgtgaggac
gacaagattgccgacctgaacttcctcattgggccgaagctgtacgaagccaactggttg
gagctgcagaagcgaggctacatcgcccgagttcagtgcgccgaagtgtggtgcccgatg
gctccggagttttaccgcgaatatctcgtcacgaagacgtccaaaaagatgctgctgtac
gtaatgaacccgcaaaagttccgcgcctgtcagtatctgatccgctaccacgagaaacgt
ggcgacaaaacgatcgtcttcagcgataacgtgttcgccctcaagcactacgccatcaag
atgaacaaaccgtacatctacggccccacctctcagaacgagcgaatccagatcctgcag
aacttcaagttcaaccccaaagtgaacaccatcttcgtgagtaaggttgccgacaccagt
ttcgatttgcccgaagcgaacgtcctgatccagatctcctcgcacggaggttcccgacgt
caggaggcgcaacgtctcggccgtattctgcgcgcaaaaaagggcgccatcgcggaagag
tacaacgcgttcttctacacgctcgtctcgcaggacacgctcgagatgggctactcgcgc
aagcgtcagcggttcctggtgaaccagggctacagctacaaggtgattacgcacctggcc
ggcatggagagcgatccggatttgttctacaagacgcgcgaggagcagggccagctgctg
cagcaggttctgtcggcgtccgacatggactgcgaggacgagcgcattccgggtgagggg
ggagcgccgaggccgggcgggtcgaagcgaactggcgggctcagctcgatgtccggcgcg
gacgacgcggtgtacatggagttcaggaagaagaaggagcatctgcatccgctgtttaag
aagtttaggggataa

DBGET integrated database retrieval system