KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007194
Entry
CpipJ_CPIJ007194  CDS       T01079                                 
Name
(GenBank) N-glycosylase/DNA lyase
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ007194
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ007194
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     CpipJ_CPIJ007194
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CpipJ_CPIJ007194
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CpipJ_CPIJ007194
SSDB
Motif
Pfam: OGG_N HhH-GPD HHH Kazal_2 Alkyl_sulf_dimr
Other DBs
NCBI-ProteinID: EDS30008
VectorBase: CPIJ007194
UniProt: B0WKR6
AA seq 365 aa
MASRTWQKIPCLSSQLQLKTTLTGGQSFRWKPHGTCSDEFVGVFANIVWILKQSKSELLY
RIVGELPYPVKETSAAIRFKVSEPERAPGVGGDLLYSLNYYEQLLRIYFRLDVDLEECYR
QWTKCHVHFESSADQFYAVRQLDQDPVENLVSFICSQNNNISRISGLVEKICSHYGEKIC
DYDGTTYYNFPDVARLAPPAVEAHLRDLSFGYRAKYIQKSAEEIVSKGGLEWFRTLQRLD
YKEAHRELLTLTGIGPKVADCICLMSLNHLQAIPVDTHVFQIAKHYLPQLGGKQTKSITG
RLYGEIGDKFREIYGERAGWAQTVLFCADLRQFKQDEAAKEGAGCGGTKRVVELTKAKPD
KKRKR
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcctcccgtacgtggcagaaaataccctgcctcagcagccagctgcagctgaaaacg
accctcaccggcgggcagagcttccgctggaaaccgcacggcacctgttcggacgaattt
gtcggcgtatttgcgaacatcgtttggattctgaagcagtccaagtccgagctgctgtac
cgaatcgtgggcgaacttccgtatccggttaaggaaacatcggcggccatcaggtttaag
gtttccgaaccggagcgtgcaccgggcgtcgggggagatttgctgtattcgctgaactat
tacgagcagttgctgcggatttacttcaggctggatgtggatctcgaggaatgttaccgc
cagtggaccaagtgtcacgtgcactttgagagcagcgcggatcagttctacgccgtgcgg
cagctcgaccaggatccggtggagaatctggtctcgttcatttgcagccagaataacaac
atttccaggatctccggcctggtggagaagatctgctcgcattacggggagaaaatctgc
gactacgacggcaccacttattataatttcccggacgttgcccggctcgctccaccggcg
gtggaagcccacctgcgtgacctgagcttcggctatcgcgccaagtacatccagaaatcc
gccgaagagatcgtctcgaagggtggcctcgagtggttccgcacgctgcaacggctcgac
tacaaggaagcccaccgggagctgctcacgctgaccgggatcgggcccaaggtggcggac
tgcatctgcctcatgtcgctgaaccacctgcaggccattccggtggacacgcacgtgttc
cagatcgcgaagcactatctgccccagctgggcggcaagcagaccaaaagcattacgggc
cggttgtacggcgagataggggacaagtttcgggagatttacggcgagcgggcgggctgg
gcccagacggtgctgttttgtgccgacctgaggcagttcaagcaggatgaggcggccaaa
gagggggcaggttgtggcggaacaaaacgagtggtggaactgaccaaagccaagccggac
aaaaagaggaagcgatag

DBGET integrated database retrieval system