KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007351
Entry
CpipJ_CPIJ007351  CDS       T01079                                 
Name
(GenBank) terminal deoxycytidyl transferase rev1
  KO
K03515  DNA repair protein REV1 [EC:2.7.7.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ007351
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ007351
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-
     CpipJ_CPIJ007351
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    CpipJ_CPIJ007351
SSDB
Motif
Pfam: IMS BRCT_2 IMS_C UBM REV1_C BRCT IMS_HHH LIG3_BRCT PTCB-BRCT BAF DUF1805 Cdd1 AT_hook Tristanin_u2
Other DBs
NCBI-ProteinID: EDS29710
VectorBase: CPIJ007351
UniProt: B0WKB9
AA seq 1038 aa
MKRKEKFASETGFEGWGDYMDAKISKLEEQFRHNAANVELKLSNLFDGISIFVNGYTSPS
AEELKRLMMQHGGTFHHYKRPTTTYVIASILPDVKVKSITSDIILRPQWVVDCIAQNLIV
DYKPYLLYSNSSKASQPKLAFGRLDKQEDLRKPVHKAEGKDDINRDEFMNLMSKLHVLNE
QMKAAPVEVVSEETKKSDSRTALVATDPNFLPEFFAHSRLHHIATLGSGFKQHVSELREA
HDGKFPARDTLAQEIPTAKSDEFEATPAAGPLIMHIDMDCFFVSVGLRSHPELRGQPVAV
THSKGSEAGTMQTRPGQDRAKEIELYQKRLEERYKTPDIPYESRLLNVTDNNSMSEIASC
SYEARQKGVKNGMFVGSALKLCPELKTIAYDFEGYKEVAFALYNTVAKYTLNIEAVSCDE
MFVDLTDLISSTGLDVMDFVSFLRAQIKQVTGCPCSAGVGANRLQARMATKRAKPNGQYY
LAPDGVEEYMRDIAIGELPGIGPSTSYRLKQLGFGTCGDLQNVAVAILQREFGKKFGDMI
YQACRGVDERPLVYDKVRKSVSVDVNYGIRFKAEGEVERFMKQLTEEITKRLCEIKQRGK
LVTVKLLVRSPEAPVETAKYMGHGLCDIITKSQPLKEYSCELEVIQRAVLGLMKQIAAPP
HELRGIGLQISKFEEKKSHAETKNSLKSMFQKVEAKNAIAPKKEPSPVKLELTPRKLEVT
PTKAAPSPSTPKVSPKRTETKSKTQPPKFGRGRGRPPKYLSLNKSKQTNDMTKFLRDSKS
DHPKDPEPIPEGLDPEVLAALPDDIRAEVIKDYKFQAKLQKNSAAPANQPVKVEQVSPPQ
QPSTSGLKPPAPIPDSPEKTNKICVDFKFLQALPPELRQEVERQIELQKDTMVITSTEPE
FEERLQVTPEASPVKAEQIVAEEDDEGENVLLRPNWRQLLTAWVESGDVPEPVDVDMIAA
GACDLIERKMLYELQQALRLLNRTIGEQVGGGCGWHGAYCRIVERVQVGMVAGYGTKLAV
PKGFECGECCNVKDEGKE
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgaagcggaaggagaagtttgccagcgaaactggcttcgaaggatggggtgactacatg
gatgcaaaaatctccaaacttgaggaacagttccgtcacaacgccgccaacgtcgagttg
aaactgtccaaccttttcgacggaatctcgatctttgtcaacggttacacgtcaccttcg
gccgaagagttgaaacggctcatgatgcagcacggtggcacgtttcatcactacaagcgc
cccacgacgacctacgtgatagcgtcgattctgccggacgtgaaggtcaaatcgatcacc
tcggacattatcctccgtccgcagtgggtcgtcgattgcatcgctcagaacttgatcgta
gattacaaaccgtacctgctgtattcgaacagctcgaaagcttcgcagcccaagctggcc
tttggacggttggacaagcaggaagatctgcggaagccggtacataaagctgaaggaaag
gacgacatcaatcgggacgagtttatgaacttgatgagcaaactgcacgtgcttaacgaa
cagatgaaggccgccccagttgaagttgtttctgaagaaaccaaaaaatccgactctcga
acagccctcgtcgcaacggatccaaactttctcccagaattcttcgcccactcccggctg
caccacatcgccacactagggtccggcttcaagcagcacgtgagcgaactccgcgaagcc
cacgacggcaagttccccgcgcgggacaccctcgcccaagaaatccccaccgccaagtcg
gacgagttcgaagcgacccccgccgccggtccgctcatcatgcacatcgacatggactgc
ttcttcgtgtcggtcgggctgcgcagccatcccgagctgcgcggtcaaccggtggccgtg
acgcactcgaaaggttccgaagcgggtacgatgcagacgcgaccgggtcaggaccgagcg
aaggaaatcgagctgtaccagaagcggctcgaggagcgctacaagacgccggacattccg
tacgagtcgcggctgctgaacgtgacggacaacaactcgatgtcggagattgcctcgtgc
agttatgaggcgcgccagaagggggttaagaacgggatgtttgtcgggtcggcgttgaag
ctgtgcccggagctgaagaccatcgcgtacgatttcgaggggtacaaggaggtggcgttt
gcgctgtacaatacggtggccaaatacaccctcaacatcgaagcggtcagctgcgacgag
atgttcgtcgacctgactgaccttatctccagcaccggcttggacgtgatggactttgtg
tcgtttttgcgcgcccagatcaaacaggtaaccggctgtccatgctcggccggagttggc
gccaaccggctgcaagcccgaatggccaccaagcgggccaagccaaacgggcagtactat
ctggcgccggacggggttgaggagtacatgcgggacattgcgatcggggagctgcccggg
attgggccgagcacgagctaccggctgaagcagctcgggtttgggacttgtggagatttg
cagaacgtggccgtggcgattttgcagcgtgagtttgggaagaagtttggcgatatgatt
tatcaggcttgtcggggggtggatgaacggccgttggtttacgacaaggttcgcaagtcg
gtgtcggttgatgtgaattatgggattcggtttaaggcggagggggaagtggagcggttc
atgaagcagctgacggaggagattactaaacgtttgtgtgagattaagcagcgggggaag
ttggtcacggtcaagttgcttgtgagatcgccggaagctccggttgagacggcaaagtat
atgggccatgggctgtgcgatattattaccaagtcgcaaccgttgaaggagtacagctgt
gagttggaggtcattcagcgagctgtactggggttgatgaaacagatcgcggcaccgccg
cacgaactccgtggaattggtcttcagatatccaaatttgaagagaagaagtctcacgct
gagacgaaaaattcgctgaagagcatgttccagaaggttgaagctaagaacgcgatcgcc
ccgaagaaggaaccttcccccgtcaagttggaactgacacctcgaaagcttgaagttact
ccaacaaaagcggccccgagtccgtcaacgccgaaggtgtccccaaagcggaccgaaacc
aaatctaaaactcaaccgcccaagtttggccgaggacgaggtcgcccgccaaagtacctc
tcgctgaacaagtccaagcagactaatgacatgacaaaatttctcagagattccaaatcc
gaccatcccaaagacccggaaccaatcccggagggactcgacccggaagtgctggccgcc
ctaccggacgacatccgcgccgaagtgatcaaagattacaagtttcaagctaaacttcaa
aagaattccgctgcaccagcgaaccaacccgtcaaggtcgaacaagtgtccccacctcaa
cagccgtccacttccggtctcaaacctccggccccaattccggatagtccggaaaaaaca
aacaaaatctgcgtcgacttcaaatttctccaagccctgccgccggagcttcgccaggag
gtcgaacgccaaattgaactccagaaggacacgatggtcatcacgagcacggagccagag
tttgaagaacgcctgcaggtgaccccggaagcgagtccagtgaaggcggaacaaatcgtc
gccgaggaggacgacgaaggcgaaaatgtgctgcttcggccgaactggcgccaactgcta
acggcctgggtcgagagcggggacgtgccggaaccggtcgacgtggacatgattgcggcg
ggggcgtgcgatttgatcgagcggaagatgctgtacgagctgcagcaggcgcttcggctg
ttgaaccggacgatcggggagcaggttgggggtggatgtggttggcatggggcgtactgc
agaattgtggaacgggttcaggtgggcatggtggcgggttacgggacgaagctggccgtt
ccgaaggggttcgagtgtggggagtgttgcaatgttaaggatgaggggaaggagtaa

DBGET integrated database retrieval system