KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007633
Entry
CpipJ_CPIJ007633  CDS       T01079                                 
Name
(GenBank) ATP-dependent DNA helicase hus2
  KO
K10901  bloom syndrome protein [EC:5.6.2.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ007633
   03460 Fanconi anemia pathway
    CpipJ_CPIJ007633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ007633
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ007633
Enzymes [BR:cqu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     CpipJ_CPIJ007633
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    CpipJ_CPIJ007633
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     CpipJ_CPIJ007633
    Bloom's syndrome complex (BTR)
     CpipJ_CPIJ007633
   FA (Fanconi anemia) pathway
     CpipJ_CPIJ007633
SSDB
Motif
Pfam: RQC DEAD Helicase_C RecQ_Zn_bind HRDC ResIII Helicase_Sgs1
Other DBs
NCBI-ProteinID: EDS29175
VectorBase: CPIJ007633
UniProt: B0WJH9
AA seq 1437 aa
MSRKAPAGSSSKSDPKKQTSLKAFMAKKEPERSSSPVASVVTANDEKAKLISPSIFKPKV
PRFKSKVEINPPKTVEILSSDSDGSPVKPRGKVSRVLSNDSLFEQPKNTSTADTETGQLD
EYDLLVSKYCSQAAIVSQQLELELQNDTRYQEATKKLEANLAKISPQKPVGEGTSKGKFQ
YKVPKAQGGSLLAGLAEPLRKPIDLNDSSGSAKLEDDDDVFEFKKRAKPASCSTPVFKPK
APSSAAATIDSPPIFKPKVPSMVNNETPPTLFKPKAPLSLSNSKPLNPTASEFVPKETPP
KFTFVPKQPVFGSTSKPAPLESTSDTLDRLLSPTKPKSTVQFDPELDDLMIDVLNDSRFK
SKELSEAEVKKSCQYLQETSHVLLEKFYDIIAQIPDEHFNAIQGFRTGTYSKLKSLIENV
RGKTKVSKKALENFKNLKKSSATGSRKSHSSTATRRNSLLDMVDGEPPPKSNGFTTSSVV
YDEVFDVPETELFEPEMEQPPQQPPTPPAAEKTKPPAFVFKKPVYGATTPIGNKSVTLEQ
EDYVDDEEDIDSIMENIREAELIDQGKVNRRQLESIDLVTPESSFRRSEPRITFNAQETS
LRNTQFIENVETQVDDDGWQVYDATQFESSNVIAVADSPPAPSASQQPFVPKPQNSLGNF
HSGVRNDGLTGEFDGMKYPHSDTLQIVFRETFGLRSFRPNQLQVINATLLGHDCFVLMPT
GGGKSLCYQLPAIMTEGVTIVVSPLKSLIHDQVNKLGSLDIPAAHLSGEVSYADQQKIYA
DLSSPKPVLKLLYVTPEKISSSGRFQNILTELYRMKQLGRFVIDEAHCVSAWGHDFRPDY
KKLSVLREQFPTIPVMALTATANPRVRIDVLKQLGLGRNTKWFLCSFNRPNLKYIIRPKQ
GVATKAEIMELIKKKFPRATGIVYCLSKKDCDQLSAEMRCAGIKAKSYHAGLGDAEREAT
QKDWITDKIKVVCATIAFGMGIDKPDVRYVIHHSMPKSIEGYYQEAGRAGRDGELATCVL
FYNYSDMLRYRKMMDHDSSIPFEAKQVHLHNLFRMVNYCENVADCRRTQQLDYFAEHFTR
EQCLENRASACDNCLMQNEYKTVDATDDCIAIAKSVRDLCAGRNRFTLLHLVEVFKGSEQ
KKIMENGHNRTAYHGRLKAWDRSDIQRLMHKLVIEDYLKEDLIFSNDIPQAYIKIGSRIE
KLMNREVRISFSLKEKTAGKRVQQIDVGNEQKQLDTQSNAQIKELQERCYNDLLEICRSL
AAQKNVTLASVMNMQALKAMAERLPESQQEMLALPHVTKANFEKYGQQLLEITQNYAAEK
LSLMLDLEAIGGGGGDGDSEDSGSESGDDGTDWGRLAREASASGSAGSGKRRRSWGAGGR
GTKRFRKGRAKSKTGGRAKATGARGAAAKRGATRGGSSSRGGRSGGSGLGLLPMPGW
NT seq 4314 nt   +upstreamnt  +downstreamnt
atgtctcgaaaggcacccgcgggctcgtcgtccaaaagtgaccccaaaaagcaaaccagc
ctgaaggcattcatggctaagaaggaaccggaacgatccagcagcccggtggcgtccgtt
gtcacagcaaacgacgagaaggctaagctgatatcgcccagtattttcaaaccgaaggtt
ccacggttcaagagcaaggttgagattaatccgccgaaaaccgttgaaatcctgtcgagt
gactcggacggttcaccggtgaagccgcgaggcaaagtgtcccgcgtgttgtccaacgac
agtctgtttgagcagccgaaaaacacatccacggcggacacggaaaccggccagctggac
gagtacgatttgctcgtgtccaagtattgctcgcaggcggccattgtgtcccagcagctt
gagctggagctgcagaatgatacgcgctaccaggaagcgacgaagaaattggaggccaac
ttggcaaagattagcccgcagaagcctgtcggtgaaggtacgagcaagggcaagttccag
tacaaagtgccgaaagcgcaaggaggatcgctgctggccggattggccgaaccgcttcgg
aagccgatagacctgaacgatagtagtggttcggcgaagctggaagacgacgatgatgtg
tttgaatttaagaaaagggccaaacctgcttcttgctcgacaccggtttttaagccgaaa
gcgcctagctcggccgcggcgaccatcgattcgccgccgattttcaagccgaaggtgcct
agcatggtgaacaacgaaacgccgccaacgttgttcaaacccaaagctccgctgagtttg
tccaactcgaaaccgttgaatccaactgcctcggaattcgtcccaaaggagacgccgcca
aagtttacgttcgtcccgaaacaacccgtttttggttccacctcaaaacctgccccactc
gaaagcacgtcggatacgttggaccggctgctgagtccgaccaagccaaaatccaccgtc
cagtttgaccccgagttggacgacctcatgatcgacgttttgaacgactcgcggttcaag
tccaaggaactgtccgaggcggaagtcaagaaaagctgccaatacctgcaagagacaagc
cacgttctgctggagaagttctacgacatcatcgcgcagattcccgacgaacactttaac
gcgatccaaggcttccggacgggtacgtacagcaagctaaagtcgttgatcgaaaacgtt
cgcggcaagacgaaggtgagcaaaaaagcgctggaaaacttcaagaacctcaagaagtcg
tccgcgacgggatcgcgaaaaagccacagctcaactgccacacgcagaaacagcctgctg
gacatggtcgacggcgaacctccgccaaagagcaacgggtttacgacgtcgtccgtcgta
tacgacgaggtctttgacgtgccggaaacggaactctttgagccggaaatggaacaacct
ccacagcagccgccgacgccgccggctgctgaaaagacgaaaccaccagcgtttgtgttc
aagaagcccgtctacggcgcgacgaccccgattggcaacaagtcggtaacgctcgagcag
gaggactacgttgacgacgaggaggacattgacagtattatggagaacattcgcgaggcc
gagctgattgatcagggtaaggttaaccggcgccagctcgaatccatcgatcttgtaacg
ccggagagttcgttccggcggtcggaaccgcgaatcacgttcaacgcgcaggaaacgtcc
ctccgcaatactcagttcatcgagaacgtcgaaactcaggtggacgacgacggttggcag
gtttacgacgcgactcagtttgaaagctccaacgtgatcgccgttgcggactcgccgccg
gcgcctagcgcaagtcagcagcccttcgtcccgaagccgcaaaattcgttgggcaacttc
cattcgggtgtgcgcaacgacggtcttaccggagagtttgacggtatgaagtatccgcac
tcggacacgctgcagatcgtgttccgtgaaacgtttggtctgcgttcgttccggccgaac
cagctgcaggtgatcaacgcgaccttgctgggccacgactgcttcgtgctgatgcccacc
ggcggtggcaaatcgctgtgctaccagttgccggccattatgaccgagggagtcacgatc
gtggttagtccgctgaaatcgctgatccacgatcaggtgaacaagctcggatcgctcgac
attccggcggcgcatctttccggtgaagtttcatacgcggatcagcagaagatctacgca
gatcttagcagcccgaagccggtgctgaagttgctgtacgtgacgccggagaagatctcc
tcgtcgggacggttccagaacattctgaccgaactgtaccggatgaagcagctcgggcgt
ttcgtcatcgacgaagcgcactgtgtgtccgcgtggggtcacgacttccggccggactac
aagaagctgtcggtgctgagggagcagttcccaacgatcccggtgatggccctcacggcg
accgccaatccccgcgtccggatcgacgtcctgaagcagcttgggctgggacggaacaca
aagtggttcctgtgcagcttcaaccggcccaatctcaagtacatcatccggcccaagcag
ggcgttgcaacgaaggccgaaatcatggaactgatcaagaagaagtttccgcgcgccacc
ggaatcgtgtactgcctttcgaagaaggactgcgaccagctgtcggcggagatgcgctgt
gcgggcatcaaggcgaagagttaccacgcgggactgggcgatgcggagcgggaggcgacc
cagaaggactggatcacggacaagatcaaggtggtgtgtgcgacgatcgcgttcgggatg
ggcattgacaagccggacgtgcggtacgtgattcaccattcgatgccgaaatctatcgaa
gggtactatcaggaggcgggtcgggctgggcgtgacggcgagttggccacgtgcgtgttg
ttctacaactattcggacatgctgcgctaccggaagatgatggatcacgactcgtcgatt
ccgttcgaggcgaagcaggtccatctgcacaacctgttccggatggtcaactactgcgag
aatgtggcggattgtaggcggacgcagcagctggactactttgcggaacatttcacccgg
gagcagtgtctggagaaccgggccagtgcttgcgacaactgccttatgcagaacgagtac
aagacggtggacgcgacggatgattgcattgcgattgcgaagagtgtgcgtgacttgtgc
gctggccggaaccggtttacgttgcttcatctggtcgaggtgttcaagggaagcgaacag
aagaagatcatggaaaatggccacaaccggacggcgtaccacgggcggttgaaggcgtgg
gatcgcagtgacatccagcgattgatgcacaagctggtcattgaggactacctgaaggag
gacctgattttcagcaatgatattccgcaggcatacatcaagattggtagccggatagaa
aagctcatgaacagggaagttcgcattagcttctcgctcaaggagaaaaccgccggcaag
cgcgtgcagcaaattgacgtcggcaacgagcagaaacagctggacacccagagcaatgcc
cagatcaaggaactgcaggaacgctgctacaacgacctgctggagatttgtcgctcgttg
gctgcccagaagaatgtcacgctggcttccgtgatgaacatgcaggcgctcaaggcgatg
gccgaacgtcttccggaatcgcagcaggagatgctggccctgcctcacgtgaccaaggcc
aactttgaaaagtacggccaacagctgctcgaaatcacccagaattacgccgcggaaaaa
ctcagtcttatgctagatctggaagccatcggcggaggaggaggcgacggagattccgag
gacagtggaagcgaaagcggcgacgacggcaccgactggggtcggctagcgcgggaagcg
tccgcgagtggatcggctggctcgggcaaacgaagacgcagctggggcgcgggcggtcga
ggaacgaagcgattccggaagggacgcgccaagtccaaaaccggtggacgagcgaaggca
accggagcgcgtggtgctgcggcgaaacggggcgcgacgaggggtgggtcgagtagccgg
ggtggacgatccggtggatccggtttgggactgctgccgatgcccggttggtga

DBGET integrated database retrieval system