KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008666
Entry
CpipJ_CPIJ008666  CDS       T01079                                 
Name
(GenBank) DNA polymerase epsilon
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ008666
   03410 Base excision repair
    CpipJ_CPIJ008666
   03420 Nucleotide excision repair
    CpipJ_CPIJ008666
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ008666
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ008666
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ008666
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    CpipJ_CPIJ008666
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      CpipJ_CPIJ008666
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 NAPRTase_C APP_N
Other DBs
NCBI-ProteinID: EDS31604
VectorBase: CPIJ008666
UniProt: B0WNF0
AA seq 2195 aa
MAKQVQNTGKYIAERTDGDDTNEIGYRQSKENDKIDLKYGFERVKDTQERTGYLVNMHST
EILNQDRRLVAALDLYFLQMDGTRYKMTVVFAPYLLLITREGHALEVAKFLAKKYSGQLL
RCEHVQKEDLDLPNHLSGLKQNLLKLTFANTGQMQKVRKDLAAAVRKNKERDKANTYYMQ
MLSSSLAVGGEEGEGSAVAGGQNQDFYESIMDMREHDVPYHVRVSIDLNIFCGLWYTMRC
RGGDEPPIVTPRPDILDRPEPVVLAFDIETTKLPLKFPDAQTDQIMMISYMIDGQGYLIT
NREIISADVEDFEYTPKPEFEGQFIVFNEPNEMGLIQRFFDHILDVKPHIFVTYNGDFFD
WPFVETRAAVYDLDMKREIGFSKTNARDGNYLCRPAMHMDCLCWVKRDSYLPVGSQGLKA
VAKSKLRYDPVELEPEDMCRMAVEQPQVLSNYSVSDAVATYYLYMKYVHPFIFALATIIP
MEPDEILRKGSGTLCESLLMKEAFHVNIVYPNKQVSELNKLTPDGHVLDMETYVGGHVEA
LESGVFRADIATRFRLDQGMLKQLQGNVAKVLEHAIVTEEGVPLDQVTNLEEVTEQIKAA
LQQLHDTPTRIEQPVIYHLDVGAMYPNIILTNRLQPSSMISETDCAACDFNKPDARCKRD
MEWMWRGEMLPATRNEFQRIQQQLETEKFPPLFPGGPPRAFHELSKEDQANYEKKRLGDY
CRKAYKKTKITKLETRTSTICQKENSFYVDTVRAFRDRRYEYKALTKVAKASVSAALKSG
DAGEIKAAKGREVLYDSLQLAHKCILNSFYGYVMRKGARWHSMSMAGIVCLTGANIITKA
REIIERVGRPLELDTDGIWCILPASFPQEFTVLTKHPKKGKLNVSYPNAVLNTMVKDHFT
NEQYHVLEKPYKDGSPAEYSIQPENSIFFEVDGPYLAMVLPAAKEEGKKLKKRYAVFNFD
GSLAELKGFEVKRRGELQLIKIFQSSVFEAFLQGSTLEQCYASVAKIADYWLDVLYSKGH
NMPDSELFELISENRSMSRKLEDYGAQKSTSISTAKRLAEFLGDQMVKDAGLACKFIISR
KPDGAPVTERAIPLAIFQSEPSVRRHYLRRWLKDNTMGDADIRDVLDWQYYIERLGGTIQ
KIITIPAALQGLNNPVPRVQHPDWLHKKMLEKNDTLKQRRISEMFVAKEKPAMADIEDLG
RGPRSPSVGLPIVNSKRRRVPSSEEPQPSQEAVAKTWKEALGAPPPPGTTRAELQEWLRF
HKKKWKWLLAQRSKHRDPSSKRSRRDDEESQLASSSGTMRPVATLGGFLRKTQRSLIEQP
WQVIQVIATDEMGHFTIWAMVGEELHKIRLLIPRIFYVNQRTPAPPEEGSMWKKVHRILP
RARPVCHLYQYVVPEQVFRDNRLGMLADLATPDIEGIYETQMTLEFRAIMELGCYCAVQR
SEARALASLSTKDLDSFNIQQLEIRSFEGPQYLRDGGNLRKIFLYQHSVPSGKREMWGLF
MGPSKKAVVIVLDTVRTNQLPTLKNLYTSERLALLKGESENFTEDSLPPADMTFESFMEI
DQKQVYQKLSRLLSAYKDEKRGPTILCVQTALGLQKLNQLIPVCLEFPETQIHIADDASL
LSGLEWQRHGARSMVRHFLNLNHVVEMMLDQCRYFQLPIGNMPADTVLFGADLFYARHLL
KSNFILWWSPSSRPDLGGREADDSRLLAEFEDNISVVQNRSGFYGTVCVELSIESLAVSA
LLQAGKVQEMEGASSAITFDVIPQASLDDMISNQGGVQTLPSYDETALCSQAFRVMRSMV
NGWLREVSINRNIFSDFQIIHFYRWVRSSKALLYDPALRRALNTLMRKLFLQIIAEFQRL
KAEIIYADFNRIVINTGKKAVMDAIAYTDYVVQSIRNKELFHSVSLSYQQSWEFLLWIDS
SNFGGIRGNPQTGNDEDVPQADEPEELSLEMSWNIAEQLPEEGNCRVYFEQFLIKYLESL
ADGVAAQKTIKKLSHVAYDMVQKMHKNYGRGKEGPALEFIKALCKVLAVNKEIDEELTTL
RRNMLLLVGIGDFSDKAVWKDPLRSYVLAEVICKACNHCRDLDLCKDNHRALKDGLPVWL
CAQCNVDYDNVDIEMRLLDVVQRKMMSYTLQDLRCNRCRQIKRENIAQFCPCAGAFENLI
SAGELRRLLGTFLTVADDHRMPLLKETIEHVLKTN
NT seq 6588 nt   +upstreamnt  +downstreamnt
atggccaagcaggttcaaaacacgggaaagtacatcgcggagcgaaccgatggggacgac
acgaacgaaatcggctatcgtcagtcgaaggagaacgataaaatcgacttgaagtatggg
ttcgagcgggttaaggacacccaggagcggaccggctacctggtcaacatgcactcgacc
gaaatcctgaaccaggaccggcggctggtggccgcgctcgatctgtactttctgcagatg
gacggaacgcggtacaagatgacggtggtgtttgcgccgtacctgctgttgatcacgcgc
gagggtcacgccctggaggtggcaaagtttctggcgaaaaagtactccggccagctgctg
cgctgcgagcacgtccagaaggaggatctggacctgccgaatcatttgagcgggttgaag
cagaatctgctcaagctgacgttcgcgaacacgggccagatgcagaaggtcaggaaggat
ctggcggcggcggtgaggaagaacaaggaacgggacaaggccaacacgtattacatgcag
atgttgagcagttcgctggcggtgggtggcgaggagggggaaggctcggcggtggcgggt
ggtcagaatcaggacttttacgagagcatcatggacatgcgggagcacgacgttccgtac
cacgtgcgggtgtcgatcgatttgaacatcttctgcgggttgtggtacacgatgcggtgt
cgagggggtgatgaaccgccgattgttacgccgcggccggatattttggaccggccggag
ccggtcgtgctggcgttcgatatcgaaaccacaaagttgccgctgaagttcccggacgcg
caaaccgatcagatcatgatgatctcgtacatgatcgatggtcaggggtatttgatcacg
aatcgggagatcatcagcgccgacgtggaggactttgagtacacgcccaagccggagttc
gaggggcagtttatagtgttcaacgagccgaatgagatgggcctgattcagcgattcttc
gatcacattttggacgtgaagccgcacatcttcgtaacctacaacggagactttttcgac
tggccatttgtggagacccgtgcggccgtgtacgacctagatatgaagcgggagattggc
ttttcaaagacgaacgcacgcgatgggaattacctttgccgtccggccatgcacatggac
tgtctgtgctgggtcaagcgtgactcgtatctcccggtgggatcgcaaggtttgaaagcc
gtcgccaagagcaaactccggtacgacccggtcgaactcgaacccgaagacatgtgtcgg
atggccgttgaacagccccaagtcctgtccaattactccgtctcggacgccgtcgccacc
tactatctctacatgaagtacgtccacccgtttatctttgccttggccaccatcatcccg
atggaaccggacgaaatcctccggaaaggttccggaaccctctgcgaatcgctccttatg
aaagaggccttccacgtcaacatcgtctacccgaacaagcaagtctccgagctcaacaaa
ctaacccccgacggccacgtcctggacatggaaacgtacgtcggaggtcacgtcgaagcg
ctggaatccggagtctttcgcgcggacatcgcaacccgcttccgccttgatcaaggcatg
ctcaagcaacttcaaggcaacgtcgccaaagtcctcgaacacgccatcgtcaccgaagag
ggcgtccccctcgatcaggtcaccaacctggaagaagtcaccgaacaaatcaaggccgct
ctccagcaactccacgacaccccgacccgcatcgaacagcccgtcatctaccatctggac
gtcggcgccatgtaccccaacatcatcctcacgaaccgcctccaaccctcgtccatgatc
tccgaaaccgactgcgccgcgtgcgacttcaacaaaccggacgcccgctgcaaacgcgac
atggagtggatgtggcgcggagaaatgctcccggcgacccgcaacgagttccagcgcatc
caacaacaactcgaaacggaaaagttccccccactcttccccggcggacccccccgcgcc
ttccacgaactctccaaagaggaccaggccaactacgagaagaaacgcctcggcgattac
tgccgcaaggcgtacaaaaagaccaaaatcaccaagctggaaacgcgcacctccaccatc
tgccaaaaggagaacagcttctacgtggacacggttcgggcgttccgcgaccgtcgctac
gagtacaaggcgctgacgaaggtcgccaaggcgtccgtttcggcggcgctcaagagtggc
gatgccggggagatcaaggccgcgaaagggcgcgaggtgctgtacgattcgctgcagctg
gcgcacaagtgtattctgaactcgttctacgggtacgtgatgcggaagggtgcccgctgg
cacagcatgtcgatggcggggatagtgtgcttgacgggggcgaacatcattacgaaggcg
agggagattatcgagcgcgttgggcggccgctggagctggacacggatggtatctggtgc
atcctgccagcctccttcccgcaagagttcaccgtcctcacaaagcacccgaaaaagggc
aagctgaacgtgtcgtacccgaacgccgtcctaaacaccatggtcaaggaccactttacc
aacgaacagtaccacgtgctcgagaaaccctacaaggacggttcccccgcggagtactcc
atccaaccggagaactcgatcttcttcgaggtggacggcccctacctggcgatggtcctg
ccggcggccaaggaggaaggcaagaagctgaagaaacgctacgccgtgttcaactttgac
ggctcgctggccgagttgaagggattcgaggtgaagcgccgcggagagctgcagctgatc
aagatcttccagagttcggtgttcgaggcgttcctgcagggatcgacgctggagcagtgt
tacgcctcggtggcgaagatcgccgactactggctggacgtgctgtacagcaagggccac
aacatgccggacagcgagctgtttgagctgatcagcgagaaccggtcgatgtcgcgcaag
ttggaggattacggcgcgcaaaagtcgacgtcgatctcgacggcgaaacgactggcggag
tttttgggtgatcagatggtgaaggatgcgggcttggcgtgtaagtttatcatctctagg
aagccggacggggccccggttaccgagcgggcaattccgttggcgatcttccagtcggaa
ccgagcgtaaggcggcattatctgcgtcggtggctcaaggacaatacgatgggcgacgcg
gacattcgggacgtgctcgattggcagtactacatcgagcggttgggaggaaccatccag
aagatcatcacgattccggcggcgctgcagggtttgaacaatccagtgccgcgcgttcaa
cacccggattggctgcacaaaaagatgctcgagaagaacgacacgctgaagcagcgccgc
atcagcgagatgtttgtggccaaggagaaacccgcgatggcggacattgaagatcttgga
cggggtccacgctcgccgagcgtgggactgccgatcgtcaactcgaagcgtcgcagggtt
ccttcgagcgaagagccacaacccagccaggaggcagtggccaaaacttggaaggaggct
cttggggcgccacctccacccggaacgactcgcgcagaactgcaggagtggctcaggttc
cacaagaagaagtggaagtggctgttggcgcagcgcagcaaacaccgcgatccgagctcg
aaacgatcccgcagggatgatgaggaatcgcagctggcatcttcgtccggcacgatgcgg
ccggtggccacgctcggcggttttttgaggaagacccagcgatcgctgatcgagcaaccc
tggcaggtgattcaggtcatcgcgaccgacgaaatgggccactttacgatttgggcgatg
gtcggcgaggagttgcacaagattaggttgctcattccgaggatcttttatgtgaaccaa
cgtacgccggcaccgccggaggaagggtcaatgtggaagaaagtgcaccggattctgccg
agggcgcgaccggtgtgtcacttgtatcagtacgtggttcccgagcaggtctttcgggat
aatcgactggggatgttggctgacttggccacgccggacatcgagggcatttacgagact
cagatgacgctcgagtttcgggccatcatggagttgggttgttactgtgccgtgcagcgt
tcggaggcgcgcgctttggcctcgctgtccaccaaggatctggactcgttcaacatccag
cagctggagattcgaagctttgagggaccgcaatatctgcgggatggagggaatctgagg
aagatcttcctgtatcagcacagcgttccttcggggaagcgtgagatgtggggactgttt
atgggaccgagcaagaaggcggtcgtgattgtgctggacacggttcgaacgaatcagctg
ccaacgctgaagaatctatacacttcggagcggttagcgctgcttaagggggagagtgag
aacttcaccgaggatagtctaccgccggcggacatgaccttcgagtcgttcatggaaatt
gatcagaagcaggtttaccagaaattgtcccgactgttgtcggcctacaaggacgagaag
cgtggtccaacgattctttgcgtccaaacggcacttgggctgcagaagttgaaccagctg
attccggtttgtttggagtttccggaaacgcagattcatatcgcggacgacgcttcgttg
ctgtctgggctggagtggcagcggcatggcgctcggtccatggttcggcacttcctgaac
ctgaaccacgtggtcgaaatgatgctggaccagtgccggtacttccagcttccgattggg
aacatgcccgccgatacggtcctcttcggagctgacctgttctatgcgcgacacctgcta
aagagcaactttatcttgtggtggtcaccgagctccaggccggatctgggaggtcgcgaa
gcggacgacagtcggctgctggccgagttcgaggacaacatctcggtcgtgcagaatcgc
tcgggcttctacggcacggtctgtgtcgagttgagcattgaaagtttagcagtgtcggcg
ctgctgcaagcaggcaaagttcaggagatggagggcgcttcctcggcgatcacttttgac
gtgattcctcaggcttcgctggacgacatgatcagcaaccagggcggcgttcagacgctt
ccaagttacgacgagacggcgctctgctcgcaggcgttccgcgtgatgcgatccatggtg
aacgggtggctccgcgaggtctccatcaaccggaacatcttctccgacttccagatcatt
cacttttaccgctgggtccgttcgtccaaagctctgctgtacgatccggcgctgcggcgt
gcgctgaacacgctgatgcgaaagctcttcctccagatcatcgccgagttccagcgactc
aaagcggagatcatctacgcagacttcaaccgaatcgtgatcaacacgggaaagaaggcc
gtgatggacgccatcgcgtacacggactacgtcgtgcagagcatccgcaacaaggaactg
ttccatagcgtatcgctatcctaccagcagtcctgggagtttctgctttggatcgactcg
tcgaactttggcggaatccgcggcaatccgcaaacgggcaacgacgaagatgtgccgcag
gcggacgaacccgaggaactttcgctcgaaatgagctggaacattgcggagcagctgccg
gaggagggcaactgtcgcgtttactttgagcagttcctgatcaaatacctggagtcactc
gcggacggcgtggcggcccagaaaacgatcaagaagctgtcgcacgtggcgtacgatatg
gtgcaaaagatgcacaaaaactacggccgcggtaaggagggaccggcgctcgagttcatc
aaggccctttgcaaggtcctcgcggtcaacaaggagatcgatgaagagctgacaaccctg
cgccgcaacatgctccttctcgttggcatcggtgactttagcgacaaggccgtctggaag
gatccgctgcgttcgtacgtactggccgaggtcatctgcaaggcgtgcaaccactgccgc
gatctggacctgtgcaaggacaaccaccgggcgctcaaggacgggttgccggtttggctg
tgcgcccagtgcaacgtcgactatgacaacgtggacatcgagatgcgcctgctggatgtg
gtccagcggaagatgatgtcgtacacgctgcaggacctgcgctgcaaccggtgtcgccag
atcaagcgggaaaacattgcgcagttttgtccgtgcgcgggtgcttttgagaatctgatt
tcggccggcgagctgcgtcggctgctcggcacgttcctgacggtggccgacgaccaccgg
atgccgctgctcaaggagacgatcgagcacgtgctgaagaccaattga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ008667
Entry
CpipJ_CPIJ008667  CDS       T01079                                 
Name
(GenBank) DNA polymerase epsilon subunit 2
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ008667
   03410 Base excision repair
    CpipJ_CPIJ008667
   03420 Nucleotide excision repair
    CpipJ_CPIJ008667
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ008667
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ008667
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ008667
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    CpipJ_CPIJ008667
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      CpipJ_CPIJ008667
SSDB
Motif
Pfam: DNA_pol_E_B Dpoe2NT
Other DBs
NCBI-ProteinID: EDS31605
VectorBase: CPIJ008667
UniProt: B0WNF1
AA seq 520 aa
MSEIPKIKTQIVSRFNISGYQIRSDASIFLAQYIAPMPDAERKRWLTSITGHVQGQGLDL
PVVEKRHIELAIKEASNTGLEDNESVFSVINAFDVPKFRYCEEKRKFLPVSGGPKRDLLP
GPDMKAEYIRDRYMMLWQKTSRHEMFNASKDGMVGNSVKRLTLRKIETLLATSKMNEVVI
LGLLTQLTEGKFYLEDPTGVVPIDLSETVFSSGLFCEGCFVLACGKFRDGTLKVEEMGFP
VSELASSSRAYFGTMNTWGGRSRTLLKASRNLAELEKTNREDSIVFLSDCWLDNPVVLDK
LKLLLQGYNEFPPIAIVLMGPFSKMTEDPYSLKGRFAALGEILAGCEGLKMQTEIVLVPS
CDDPTAANILPRPPLPDCLVTDLKKRYPRITLATNPCRLQYCTQQIVVFRMDLVTKLCRN
TIHFPKSGQLEDHFARTLISQGTLAPLHPIALPVHWNFDAALSLYPLPDLIVVGDPSQGF
QVTEQECTVLNTGSFPKSKFAFKVYIPSSRTVEDSQIPDD
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgagtgaaatacctaaaataaagacacaaattgtgtcccggtttaacataagtggatat
cagattcgaagcgatgccagcatcttcctggcccagtacatcgcaccgatgccggacgca
gagcgcaaacgctggctgaccagcatcaccggtcacgtgcagggtcagggtctagacctg
ccggtggttgagaagcgccacatcgagctggccatcaaagaggcgagcaacaccggcctc
gaggacaacgagtcggtattctccgtcattaacgcattcgacgtgcccaagttccggtac
tgcgaggaaaagcgcaagttcctacccgttagtggtggccccaagcgggatctgctgccg
gggccagacatgaaggccgagtacatccgcgatcggtacatgatgctgtggcaaaagacc
agtcggcacgagatgtttaacgcgagtaaggacggcatggtgggaaattcggtgaagcgg
ttgacgctgaggaagattgaaacgttgctggcgacctccaagatgaacgaggttgttatt
ctggggctgttgacgcagttgaccgagggcaagttttacctggaagatcccaccggggtg
gttccgatcgatctcagcgaaacggtcttctcgtccgggttgttctgcgaaggttgcttc
gtgctggcctgtggcaagtttcgcgacggaacgctcaaagttgaggagatgggctttccc
gtgtccgagctggcctccagcagtcgggcctacttcggaacgatgaacacctggggtgga
cgttcgcgaacccttttgaaagcgtcccgcaatctagccgaactcgaaaagactaatcgc
gaggacagcatcgtcttcctctccgactgctggctagacaaccccgtcgtcctggacaag
ctcaagctgctcctgcagggctacaacgaattccccccgatcgcgatcgtcctcatgggc
ccgttctccaagatgaccgaagatccgtactccctcaaaggtcgcttcgccgccctcgga
gaaatcctcgccggctgcgaaggcctcaaaatgcaaaccgaaattgtcctcgtcccgtcc
tgcgacgaccccacggcggccaacatcctccccagaccacccctgccagactgcctcgtc
acagaccttaaaaagcgctacccccgaatcaccctggccaccaacccgtgccggctccag
tactgcacccagcagatcgtcgtcttccggatggatctggtcacgaagctgtgccgcaac
acgatccactttcccaaaagcggtcaactcgaggatcactttgcgcggacgctcatcagt
cagggcacgctggcgccgctgcatccgattgcgcttccggtgcactggaatttcgatgcg
gcactgtcgctctatccgctgccggatttgatcgtggttggggacccgagccagggcttt
caggtcaccgagcaggagtgcaccgtgctgaatacgggatcgtttccgaagagcaagttt
gcctttaaggtttacattccgtcgtcgcggaccgtagaggactcgcagattccggatgat
tga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010897
Entry
CpipJ_CPIJ010897  CDS       T01079                                 
Name
(GenBank) DNA polymerase epsilon subunit 4
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ010897
   03410 Base excision repair
    CpipJ_CPIJ010897
   03420 Nucleotide excision repair
    CpipJ_CPIJ010897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ010897
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ010897
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ010897
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    CpipJ_CPIJ010897
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      CpipJ_CPIJ010897
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone
Other DBs
NCBI-ProteinID: EDS35581
VectorBase: CPIJ010897
UniProt: B0WVH5
AA seq 188 aa
MESEGTTSGNQPETIVENPVIPESEEIDFGDDTFPVQTVTEQEKESDEIQPDQGETEAEG
ENDVETEEAPEEELIEETELEADSAEQPDDQPTKEATSARKEPAEPRLVQLPLSKIKQIM
KLDPDVNIVSAEAIFLVTRAAELFVQNLAKEAYTHTAAGKKKTIAKRDVDMTIESVDTLM
FLEGMMNV
NT seq 567 nt   +upstreamnt  +downstreamnt
atggaatcggaaggcaccacttcaggaaatcagccggaaacaatcgttgaaaatcctgtt
atacccgagtccgaggagatcgatttcggcgatgacacattcccagttcagacggtaacg
gaacaggagaaagagagcgatgaaatccaacccgatcaaggggaaacggaagctgaagga
gagaacgacgttgaaacggaagaagcacccgaagaagagttaatcgaagaaacggaacta
gaagcggactcagccgagcaaccagatgaccagcctacaaaagaggcaacatccgctagg
aaagaaccggccgagccgcgtctagtccagttgccgctcagcaaaatcaagcagatcatg
aagctcgacccggacgtgaacatcgtgtcggcggaagccatcttcctggtgacccgggcc
gccgaactttttgtgcagaatttggccaaggaagcgtacacgcatacggcggccggcaag
aagaaaacgatcgcaaagcgggacgtcgacatgacgatcgaatccgtcgatacgctcatg
tttctcgagggaatgatgaacgtgtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016568
Entry
CpipJ_CPIJ016568  CDS       T01079                                 
Name
(GenBank) DNA polymerase epsilon subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ016568
   03410 Base excision repair
    CpipJ_CPIJ016568
   03420 Nucleotide excision repair
    CpipJ_CPIJ016568
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ016568
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ016568
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ016568
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ016568
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    CpipJ_CPIJ016568
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    CpipJ_CPIJ016568
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      CpipJ_CPIJ016568
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TAFII28
Other DBs
NCBI-ProteinID: EDS44940
VectorBase: CPIJ016568
UniProt: B0XCP4
AA seq 121 aa
MVERIEDLNLPNTVVTRLMKEALPADVKISNESRTALTRATSVFVLYLTSAATDVADKKK
QKTLTVDHVLAGLEEIEFESFIKPLKNDLENYRKLVKNKKDKKGDKPETEEAMEEDTPAD
M
NT seq 366 nt   +upstreamnt  +downstreamnt
atggtcgaaaggatcgaggacctgaacctgccgaacacggtcgtgacccggctcatgaag
gaggccctcccggcggacgtcaagatctcgaacgagtcgcggacggcgctcacgcgtgcc
acctccgtgtttgtgctgtacctgacctcggccgccacggacgtggccgacaagaagaag
caaaaaacgctcaccgtggaccacgtcctggcggggctggaggagatcgagttcgagagc
ttcatcaaaccgctgaagaacgatttggagaattaccggaagctggtgaagaataaaaaa
gacaagaaaggagacaagccggaaacggaagaggctatggaggaggatactccggccgat
atgtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ020000
Entry
CpipJ_CPIJ020000  CDS       T01079                                 
Name
(GenBank) DNA polymerase epsilon subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ020000
   03410 Base excision repair
    CpipJ_CPIJ020000
   03420 Nucleotide excision repair
    CpipJ_CPIJ020000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ020000
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ020000
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ020000
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ020000
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    CpipJ_CPIJ020000
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    CpipJ_CPIJ020000
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      CpipJ_CPIJ020000
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TAFII28
Other DBs
NCBI-ProteinID: EDS33702
VectorBase: CPIJ020000
UniProt: B0XCP4
AA seq 121 aa
MVERIEDLNLPNTVVTRLMKEALPADVKISNESRTALTRATSVFVLYLTSAATDVADKKK
QKTLTVDHVLAGLEEIEFESFIKPLKNDLENYRKLVKNKKDKKGDKPETEEAMEEDTPAD
M
NT seq 366 nt   +upstreamnt  +downstreamnt
atggtcgaacggatcgaggacctgaacctgccgaacacggtcgtgacccggctcatgaag
gaggccctcccggcggacgtcaagatctcgaacgagtcgcggacggcgctcacgcgtgcc
acctccgtgtttgtgctgtacctgacctcggccgccacggacgtggccgacaagaagaag
caaaaaacgctcaccgtggaccacgtcctggcggggctggaggagatcgagttcgagagc
ttcatcaaaccgctgaagaacgatttggagaattatcggaagctggtgaagaataaaaag
gacaagaaaggagacaagcctgaaacggaagaggctatggaggaggacaccccggccgat
atgtga

DBGET integrated database retrieval system