KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ009046
Entry
CpipJ_CPIJ009046  CDS       T01079                                 
Name
(GenBank) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ009046
   03410 Base excision repair
    CpipJ_CPIJ009046
   03420 Nucleotide excision repair
    CpipJ_CPIJ009046
   03430 Mismatch repair
    CpipJ_CPIJ009046
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ009046
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ009046
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    CpipJ_CPIJ009046
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CpipJ_CPIJ009046
   MMR (mismatch excision repair)
    Other MMR factors
     CpipJ_CPIJ009046
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    CpipJ_CPIJ009046
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1 HgmA_C Myco_19_kDa
Other DBs
NCBI-ProteinID: EDS32329
VectorBase: CPIJ009046
UniProt: B0WPF0
AA seq 260 aa
MFEARLIASTTLKKVLDAIKDLLNEATFDCSDSGIQLQAMDNSHVSLVSLSLCSDGFDKY
RCDRNLSMGMNLANMSKIMKCANNDDTVTMKAQDNADTVTFMFESQNQEKVSDYEMKLMN
LDQEHLGIPETDYACIVRMPAIEFARICRDLSQFGESVVISCTKEGVKFSASGDAGSANI
KLAQTSSVDKEDEAVIIEMQEPVTLTFACRYLNSFTKATPLSNQVQLSMSADVPLVVEYK
IQDLGHIRYYLAPKIEDDEN
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtttgaggcacgtctcattgctagcaccaccttgaagaaggttctggatgccatcaag
gatctgctgaatgaggccacgttcgactgcagtgactcgggcatccagctccaggcgatg
gacaattctcacgtctcgctggtgtcgctgtcgctttgttcggatggattcgacaagtac
cggtgcgaccggaatttgtccatgggcatgaatctggccaacatgtccaagattatgaag
tgcgctaacaacgacgacacggttaccatgaaggcccaggacaacgctgacaccgtcaca
ttcatgttcgagtcccagaatcaggagaaggtttccgattatgagatgaagctgatgaat
ctggaccaggaacatctgggaatccccgagacagactacgcgtgcatcgtccgtatgcca
gcgattgaatttgcccgcatctgccgcgacttgtcccagtttggagagtctgtcgtcatc
tcctgcaccaaagaaggtgtgaaattctccgcttccggtgatgccggttcggccaacatc
aagctggcccagacttcaagcgtggataaggaggatgaagcagtcatcatcgaaatgcag
gaaccggtgacgctcacctttgcctgtcgctacctgaactctttcacaaaagccacgccg
ctgtccaaccaggtgcagctgtcgatgtctgccgatgtgccgctcgtggtcgagtacaaa
atccaagacctgggacacattcggtactacctggcgccaaagatcgaggatgatgagaac
taa

DBGET integrated database retrieval system