KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010026
Entry
CpipJ_CPIJ010026  CDS       T01079                                 
Name
(GenBank) DNA polymerase delta small subunit
  KO
K02328  DNA polymerase delta subunit 2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
cqu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ010026
   03410 Base excision repair
    CpipJ_CPIJ010026
   03420 Nucleotide excision repair
    CpipJ_CPIJ010026
   03430 Mismatch repair
    CpipJ_CPIJ010026
   03440 Homologous recombination
    CpipJ_CPIJ010026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ010026
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ010026
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CpipJ_CPIJ010026
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CpipJ_CPIJ010026
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     CpipJ_CPIJ010026
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-ProteinID: EDS33455
VectorBase: CPIJ010026
UniProt: B0WRQ1
AA seq 455 aa
MLFPEDKNFTGAKPEGGEFKRLQVPYQYRSDKFHFKTKDFKQFAHIYATRLEEMVRLMKV
RVEHKWGSKYPVKQLADLKEDNPEQCVLIGTLFKHQELKPSILREISEENQLAPQPPRSH
YTDDADILILEDALQRIRLFGKLDVHSVVTGVVCAVRGYEDGDGRFHVEEYLFYEAGPQK
PLKSLESSPLIVLISGLNQSSPNDMSLSMELLQQWLFGNLEGFGQSRDWEASSVVRVIIA
GNSIKASSKPKSSLHNRPANDSTDLLNAVKSVDSFVHNLAQSVNVDLMPGEFDPSNHMLP
QQPMHQCMFPRSIPFQSFRGVPNPYAFEIAGRLIVGTAGQNVHDIARYSKIESPLEALES
TLIWSHLAPTAPDTLPCYPYYQQDPFIVAECPHVYFAGNVAEFGTKLWEGPEGQRTRLVC
VPSFADTHTIAVVNLRTLDCQPVCFAVNEFEDGEE
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgctgtttccggaggacaaaaactttaccggagccaaaccggagggcggcgagttcaag
cggctgcaggttccgtaccagtaccggtcggacaagttccacttcaagacgaaggacttt
aagcagtttgcccacatctacgcgacccggctggaggagatggtccggctgatgaaggtc
cgggttgagcataagtggggttccaagtatcccgtcaagcagctggccgacctaaaggag
gacaatccggagcagtgcgtgctcatcgggacgttgttcaagcaccaggagctgaagccg
agcatcctgagggagatttccgaggagaaccagctagcgccgcagccaccgcggtcgcac
tacaccgacgatgcggacattctgatcttggaggatgcactgcagcggattcgactattt
ggcaagctggacgtgcactcggtggtgacgggggtggtttgtgccgtgcgaggctacgaa
gacggtgacggtcgtttccacgtcgaagaatacctgttctacgaagccggtccccaaaag
ccgctcaaatcgctggagagctccccactaatcgtcctcatatccggactgaatcagagc
tcccccaacgacatgtcgctctcgatggagctgctgcagcagtggctgtttggaaacctg
gaaggatttggtcagtctcgcgattgggaagcgtccagcgtggttcgcgtcatcatcgcc
ggtaactcgatcaaggcgtcatccaaaccgaaaagctccctccacaaccgccctgccaac
gattccacagatctcctcaatgccgtcaaatcggtggactcgttcgtgcacaacctggcc
cagtccgttaacgttgatctgatgccgggcgagtttgatccatcaaaccacatgcttccc
cagcaaccgatgcatcagtgtatgttcccgcgatcgatcccattccagagcttccgaggc
gttccaaatccgtacgcattcgaaatagctggccgcttaatcgtgggaaccgccggtcag
aacgtgcatgacattgcccgctactccaaaatcgaatcccccctcgaagcactcgagagc
actctcatctggagtcacctagctccaactgcgccagacacgctgccctgctatccgtac
taccagcaggatccgttcattgtcgccgaatgtcctcacgtgtactttgcaggaaacgtg
gccgaatttgggacgaagctgtgggagggaccggaggggcaacgaacgcgactggtttgc
gttccttcgtttgccgatacgcacaccattgcggtagtgaacctccggacgctggactgt
cagccggtttgcttcgcggtgaacgagtttgaggacggggaggagtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012084
Entry
CpipJ_CPIJ012084  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K03504  DNA polymerase delta subunit 3
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
cqu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ012084
   03410 Base excision repair
    CpipJ_CPIJ012084
   03420 Nucleotide excision repair
    CpipJ_CPIJ012084
   03430 Mismatch repair
    CpipJ_CPIJ012084
   03440 Homologous recombination
    CpipJ_CPIJ012084
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cqu01009]
    CpipJ_CPIJ012084
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ012084
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ012084
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CpipJ_CPIJ012084
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CpipJ_CPIJ012084
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CpipJ_CPIJ012084
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     CpipJ_CPIJ012084
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-ProteinID: EDS36377
VectorBase: CPIJ012084
UniProt: B0WXB6
AA seq 484 aa
MDTAVEKSCLDEISHTVLDSKGKISVRTLSNNYEISFADAVKVLQGWIDANGAKAKLSPE
FIVRGTDSKGMPFITVANEKRLKAIKAKAERVSSMLYALEVASESGGKLNIPVDQEFRAI
ALPLKTDKRDVKVFVPVASAPAVPVVKQEAKPKSIFGASGSKVVPKAEPAKVPAVKEEKQ
SPPPAEVKKESPPKKTASSPTKVSPSKKKDAKKPVATGKSSIASFFSNKPAAAKPAAPKP
VEKPVEKPAEVKVKEEKPSPKPEPKKTAKEDETPRWKRMISDESSGDDEVIPNTPQDKKP
EKKKGGVRKPMTVKKGSGKANPSKKSRILQVEDSSEEEEEDRGLKEPEERLVAFEVEESD
DAEMKDVQELSPEKPVENDSSSANRGRAKVKKLVTKTFMDEEGYLTTIKEYQMVSASEDE
GEGESATTNNNNKSEANGKKESMATGKTGKSEPKTDKNAQPASKVTPPTPKTKQGSIMSF
FAKK
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggacaccgccgtggaaaagtcctgcctggacgaaatcagccacaccgtgctcgattcc
aaggggaagatttcggtccgaaccctgtccaacaactacgagatcagcttcgctgatgcc
gtcaaggtgctgcagggctggattgacgcaaatggggcgaaggcgaagctctcgccggag
tttatcgtgcggggaaccgactccaagggaatgccctttatcacggttgcgaatgagaag
cggctgaaagcgattaaggccaaagcagagcgtgtgtctagcatgctgtacgcactggag
gttgcgtcggaatctggcgggaagttgaacattccggtggaccaggaatttcgagcgatt
gccctgccgctcaagacggacaaacgggacgtgaaggtgtttgttccggtggccagtgcg
ccggcggtgccggtggtaaagcaggaggcgaagccgaaatcgatatttggggccagcgga
tctaaggttgtgccgaaggcggaacctgccaaagttccggcagtgaaggaggaaaagcag
agtccacctccggcggaggttaaaaaggaatcgccaccgaagaaaacggcaagttcgccg
accaaagtgtccccgagcaagaagaaagacgccaaaaagccggttgccaccgggaagagt
tcgattgcgtcgttcttttcgaacaaacctgcggcggccaagccggccgcacccaaaccg
gttgagaaacctgttgaaaaacctgctgaggttaaagtaaaggaagagaagccttcgcca
aagccggagccgaaaaaaaccgccaaggaggacgaaacgcctcgctggaagcggatgatc
tccgatgaatcttccggcgatgacgaggtcattccgaacacgccgcaggataagaagccg
gagaagaagaagggcggcgttcggaagccgatgaccgtcaagaaggggtccggtaaggcc
aacccgagcaagaagagtcgaatcttgcaggtggaggattccagcgaggaggaagaggag
gatcgcggcttgaaggaaccggaggagcgtctggtcgcgttcgaggtcgaagagtcggac
gatgcggaaatgaaggacgtacaggaactgagcccggagaagccggtcgagaacgattcg
agcagtgcgaaccggggccgggccaaggttaagaagctggtcacgaaaacgttcatggat
gaggaggggtatttgaccacaatcaaagagtatcaaatggtttcggcgtcggaggatgaa
ggggagggtgaatcagccaccaccaacaacaacaacaaatcggaagcaaatgggaagaag
gaatcaatggccaccggaaagacgggtaagtcggaaccgaaaacggataagaatgcgcaa
ccggccagcaaggtgacgccgccaaccccgaagaccaaacagggatcgatcatgagcttc
ttcgcgaagaagtaa

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018287
Entry
CpipJ_CPIJ018287  CDS       T01079                                 
Name
(GenBank) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03030  DNA replication
cqu03410  Base excision repair
cqu03420  Nucleotide excision repair
cqu03430  Mismatch repair
cqu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CpipJ_CPIJ018287
   03410 Base excision repair
    CpipJ_CPIJ018287
   03420 Nucleotide excision repair
    CpipJ_CPIJ018287
   03430 Mismatch repair
    CpipJ_CPIJ018287
   03440 Homologous recombination
    CpipJ_CPIJ018287
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ018287
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ018287
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ018287
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CpipJ_CPIJ018287
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CpipJ_CPIJ018287
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     CpipJ_CPIJ018287
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_B_exo2
Other DBs
NCBI-ProteinID: EDS26912
VectorBase: CPIJ018287
UniProt: B0XFN1
AA seq 1100 aa
MNTKRKPFTKPGGESSSASFNKKPRTGGDDDEEDFESYFEAELANMDDEGDAAAAAHSIG
QGPEAENTCAKWSRPKPREYNPEAEGLVFQQIDIDHYIGQPVPGMPGAQIGPVPVMRMFG
ITQEGNSVCAHVHGFTPYLYVAAPRGFGKSHLAEFRTALDKSVLNDMRSNKENVQEAVLD
VELVERQSIMGYNGEEKFSFIRVSVALPRLLAAVKRLLEKEQMMPSMDFQDCRVYESNID
FDIRFMVDTNVVGCSWIEIPQGKWRIRRKGKGLALETRCQIEIDVAYNEFIVHDPEGEWS
KVAPFRILSFDIECAGRKGIFPEPQHDPVIQIANMVIRQGDQEPFLRNVFTLKSCAPIVG
SQVLSYESEQELLDKWASFVRELDPDILTGYNINNFDIPYLLNRANHLKVKNFEYLGRVT
NIRSVIKETVIQSKQMGRRENKSVNFEGRVPFDLLFVLLRDYKLRSYTLNAVSYHFLQEQ
KEDVHHSIITDLQNENEQTRRRLAMYCLKDAYLPLRLLNKLMCIVNYMEMARVTGVPLQC
LLTRGQQIKVMSQLLRKTRKCGYLIPSYQSSGSDEQYEGATVIEPKRGYYADPISTLDFA
SLYPSIMMAHNLCYTTLLQPGFNKEKLGLTDDQITRTPANNTFVKASVRKGILPEILESL
LGARKRAKADLKVETDPFKRSVLDGRQLALKISANSVYGFTGAQVGKLPCLEISGSVTAY
GRTMIEQTKQEVEQRYTAENGYENDAVVIYGDTDSVMVNFGVKSLERSMELGREAAEFVS
AKFVKPIKLEFEKVYYPYLLINKKRYAGLYFTRPDKYDKMDCKGIETVRRDNSPLVANMM
NSCLQKLLIERNPEGAVEHAKQVIADLLCNRIDISQLVITKELAKTDYAAKQAHVELAAK
MKKRDAGSAPKLGDRVPYVIINAAKNTPAYMKAEDPIYVLENCVPIDANYYLENQLSKPL
LRIFEPILGEKAESILLRGDHTRTRAVVTSKVGALAAFTKKRDACLGCKALLPVGYEGQA
VCQHCKQNEAALYQNELSAQRSLEDRFCRLWTQCQRCQGSLHEEVICTSRDCPIFYMRTK
IRMELDTQEKRVRRFGVPSW
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgaacaccaaacgcaaaccgttcaccaaaccgggcggagaatcctcctcggccagcttc
aacaagaaaccacgaaccggtggcgacgacgacgaggaggactttgaaagctacttcgag
gccgagctggccaacatggacgacgagggggacgccgccgccgcggctcactcaatcggg
cagggcccggaggcggaaaacacctgcgccaagtggagccgtccgaagccgcgcgagtac
aacccggaggcggaggggctggtgttccagcagatcgacatcgaccactacatcgggcag
ccggtgccggggatgccgggggcgcagattggaccggttccggtgatgcggatgttcggg
ataacgcaggagggcaactcggtgtgcgcgcacgtgcacggctttacgccgtatttgtac
gtggcggcgccgcgtggtttcggcaagagtcacctggcggagttccggacggcgctggac
aagtcggtgctgaacgatatgcggtcgaacaaggagaacgtgcaggaggcggtgctggac
gtggagctggtcgagcggcagtcgattatgggatataatggggaggagaagtttagcttt
atccgggtgtcggtggcgttgccgaggttgttggccgcggtgaagaggctgttggagaag
gagcagatgatgccgtcgatggactttcaggactgtcgggtgtacgagagtaatattgac
tttgatattcggtttatggttgatacgaacgtggtcgggtgcagctggatagagattccc
caggggaagtggcggattaggaggaagggaaagggattggcgttggagacgcggtgtcag
attgagattgatgtggcgtacaatgagtttattgtgcacgatccggagggggagtggagc
aaagtggcgccgtttaggatcttgagcttcgacattgagtgcgctgggcggaagggaatc
tttccggagccgcagcacgatccggtgatccagatcgcgaacatggtgattcggcagggc
gatcaggaaccgtttttgaggaacgtgttcacgctgaagagttgcgcgccgatcgttggg
tcgcaggtgttgagttacgagtcggagcaggagctgctggacaagtgggcgagcttcgtt
cgcgagctggatccggacatcctgaccgggtacaacatcaacaacttcgacattccttac
ctgctgaatcgcgcgaatcacttgaaagtcaagaactttgaatatctcggtcgagtcacg
aacattcggtcggtgattaaggagacggtcattcagtccaagcagatgggacggcgcgag
aacaagtcggtcaactttgaaggtcgtgtcccgttcgacttgctgtttgtgctcctccgt
gactacaaactccgctcgtacacgctgaacgccgtgagttaccactttctgcaggaacag
aaagaggacgttcatcacagcatcattacggacttgcagaacgagaacgaacaaacgcgt
cgtcggttggcgatgtactgcttgaaggacgcctatctgccactccgtctgctgaacaag
cttatgtgcatcgtcaactacatggaaatggcccgtgtaacgggagtcccacttcagtgt
ctcctaacccgtggtcagcagatcaaagttatgagtcagctcctccgcaagaccagaaag
tgcggctatctcatcccgtcctaccagagttccggctcggacgagcagtacgaaggcgcc
acggtcatcgagcccaagcgcggctactacgccgacccaatctcaacgctcgatttcgcc
tcgctatatccaagtatcatgatggcccacaacctctgctacacgaccctcctccagccc
ggcttcaacaaggagaagctcggcctcaccgacgaccagatcacgcgaacccccgccaac
aacaccttcgtcaaggcctccgtccgcaaggggatcctcccggagatcctcgaatccctg
ctcggcgcccgaaagcgcgccaaggccgacctcaaggtcgaaaccgaccccttcaagcgc
tccgtcctggacggtcgccagctcgcgctcaaaatctccgccaactccgtgtacggcttc
actggcgcccaggtcggcaagctgccctgtctggaaatctccggctccgtcaccgcgtac
ggccgcaccatgatcgagcaaaccaagcaggaggtcgagcagcgctacaccgcagaaaac
gggtacgaaaacgatgccgtcgtcatctacggcgataccgattcggtcatggtcaacttt
ggcgtcaaatcgctcgaacgcagcatggaacttggccgcgaagccgccgaattcgtcagc
gccaagttcgtcaaacccatcaagctcgagttcgaaaaggtctactacccgtacctcctg
atcaacaagaaacgctacgccggcctttacttcacccgccccgacaagtacgacaaaatg
gactgcaagggcatcgaaaccgtccgccgcgacaactcccccctcgtcgccaacatgatg
aactcctgcctccagaagctcctcatcgagcgcaacccggaaggcgccgtcgagcacgcc
aaacaggtcatcgccgacctactctgcaaccgcatcgacatctcccagctcgtcatcacg
aaggaactcgccaaaacggactacgccgccaagcaggcccacgtcgaactcgccgccaaa
atgaagaaacgcgacgccggcagcgcccccaaactcggcgatcgcgtcccctacgtcatc
atcaacgccgccaaaaacaccccggcctacatgaaggccgaagacccgatctacgtcctc
gagaactgcgtccccatcgacgccaactactacctggaaaaccaactctccaagcccctc
ctccgaatcttcgaaccgatcctcggcgaaaaagcagaatccatcctgctccgcggcgat
cacacccgaacccgcgccgtcgtcacctccaaagtgggtgccctcgccgccttcaccaaa
aaacgggacgcctgcctgggctgcaaggcgctcctcccggtgggctacgaaggccaagcc
gtctgtcagcactgcaagcagaacgaggcggcgctctaccagaacgaactgtcggcccag
cggtcgctcgaggatcggttctgccggctgtggacgcagtgtcagcgctgccagggctcg
ctccacgaggaggtcatctgcacgagcagggattgcccgattttctacatgcgcaccaag
atccggatggagctggacacgcaggagaagcgcgtccggaggtttggggtgccgtcgtgg
tga

DBGET integrated database retrieval system