KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ010574
Entry
CpipJ_CPIJ010574  CDS       T01079                                 
Name
(GenBank) cullin
  KO
K10609  cullin 4
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
cqu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ010574
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ010574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ010574
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ010574
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ010574
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     CpipJ_CPIJ010574
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      CpipJ_CPIJ010574
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      CpipJ_CPIJ010574
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ010574
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 NurA
Other DBs
NCBI-ProteinID: EDS34192
VectorBase: CPIJ010574
UniProt: B0WT49
AA seq 759 aa
MNLAENDRKRANFSALSNTNGAVIKMTTNTGTGKPGDIKKIVIKNFKTKPTLPENYQETT
WQKLREAVIAIQLSKRIEYSLEELYQAVENMCSHKMDSQLYVNLTALAEQHVKANITPFM
AESIDKLVYLKKMNDCWQSHCQQMIMIRSIFLYLDRTYVLQNPTVHSIWDMGLELFRDHI
AMNTLVQARTVEGILILIEKERNGDAVDRALLKSLLRMLSDLQIYKEAFEQKFLVATKHL
YQSEGQAKMEVLEVPEYLLHVDKRLQEENERLLHYLDSCTKHQLIVTVERQLITEHITGI
LQKGLDQLLEENRLTDLTLLYSLFSRVKNGTIELCASFNAYIKKKGRTIVIDPEKDKSMV
QDLLDFKDKLDNIVTKCFDKNEKFSNSLREAFEFFVNQRSNKPAELIAKYVDMKLRAGNK
EATEEELEQILDKIMVQFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKQE
CGGGFTSKLEGMFKDMELSRDINIAFRQYMANSEGKELQNIDLTVNILTMGFWPTYPVME
VTLPQELLQYQSIFNKFYLAKHSGRKLQWQPTLGHCVLKARFDAGPKDLQVSLFQALVLL
LFNYSPTITFEEIKAAINIEDGELRRTLQSLACGKARVVSKIPKGREVEDNDKFQFNNEF
TNKLFRIKINQIQMKETTEEQKATEERVYQDRQYQIDAAIVRIMKMRKTLSHNLLISELY
KQLTFPVKPADLKKRIESLIDRDYMERDKDNQNQYNYVA
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgaatctggccgagaacgaccggaagagggccaacttttccgccctcagcaacacgaac
ggagcggtgatcaagatgaccaccaacaccggaaccgggaagcccggggacattaagaag
attgtcatcaaaaacttcaaaaccaagcccacactaccggagaactaccaggagacgaca
tggcagaagctgcgcgaagcggtcatcgccatccagctgtcgaaacggatcgagtactcg
ctcgaggagctgtaccaagcggtggagaacatgtgctcgcacaagatggactcgcagctg
tacgtgaatctgacggcgctcgcggagcagcacgtcaaggccaacattacgccgttcatg
gccgagtccatcgacaagctggtctacctgaagaagatgaacgactgctggcagtcgcac
tgtcagcagatgattatgattcgcagcatcttcctgtatctggaccggacgtacgtgctg
cagaatccgaccgtccactcgatctgggacatggggctggagctgttccgggatcacata
gcgatgaacacgctcgtgcaggcacgcaccgtcgaggggattctgattctgatcgaaaag
gaacggaatggggatgccgtcgaccgggcactgctcaaaagtttgctccggatgttgtcg
gacctgcagatctacaaggaagcgttcgagcaaaagttcctggtcgcgacgaagcatctg
taccagtcggaggggcaggccaagatggaagtgctcgaagttccggagtatctgctgcac
gtggataagcgattgcaggaggaaaatgaacgtctgctgcactatttggacagttgcacg
aagcaccagctgattgtgacggtcgagcggcaactcatcaccgaacacattaccggcatc
ctgcagaagggcctcgatcagctgttggaagagaaccgcctgaccgatttgacgctgctt
tattcgctgtttagccgggtcaaaaacggaaccatcgagctgtgcgcgtcgttcaacgcg
tacatcaagaagaaaggacgcaccatcgtcatcgacccggagaaggacaagtccatggtg
caggacctgctggactttaaggacaaactggacaatatcgtgaccaagtgcttcgacaag
aacgaaaagttctccaactcgctgcgagaagcgttcgagttcttcgtcaaccagcggtcc
aacaagccggccgagctgattgccaagtacgtggacatgaagttgcgcgccggcaacaag
gaagccaccgaggaggagctcgagcagatcctggacaagatcatggtccagttccggttc
attcacggcaaggacgtgttcgaggcgttctacaagaaggacctcgccaagcggctgctc
gtcggcaagtcggcctccgttgacgccgagaagagtatgttgtcgaagctgaagcaggag
tgcggcggcggtttcacctccaagctcgagggcatgttcaaggacatggagctcagcagg
gacattaacattgcgttccggcagtacatggccaactcggagggcaaggagctgcagaac
atcgacctcaccgtcaacatcctgacgatgggcttctggccgacgtacccggtgatggag
gtgacgctgccccaggagctgctccagtaccagtccatcttcaacaagttctacctggcg
aagcacagcggccggaagctacagtggcagcccacgctcggccattgcgtgctgaaggcg
cgcttcgatgctggcccgaaagacctgcaggtttcactgttccaagcgctggtgctgctg
ctgttcaactacagtccgaccattacgttcgaggagattaaggctgcgataaacattgag
gacggcgagctgcgccgtacgctgcagtcgctggcctgcggcaaggcccgcgtcgtctcc
aagatcccgaaggggcgcgaggtcgaagacaatgacaagttccagttcaacaatgaattt
acgaataagctctttaggattaagatcaaccagatccagatgaaggaaacgacggaagag
cagaaagccacggaggaacgcgtctaccaggaccggcagtaccagatcgacgccgcgatc
gtgcgcatcatgaagatgcggaaaacgctcagccacaatctgctcatcagcgagctctac
aagcagctgacgttccctgtaaagccggctgacttgaagaaacggatcgaatcgctcatc
gatcgggactacatggagcgggacaaggacaaccagaatcaatacaactacgtcgcttaa

DBGET integrated database retrieval system