KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012304
Entry
CpipJ_CPIJ012304  CDS       T01079                                 
Name
(GenBank) poly
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
cqu04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ012304
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    CpipJ_CPIJ012304
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cqu03032]
    CpipJ_CPIJ012304
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ012304
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ012304
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     CpipJ_CPIJ012304
DNA replication proteins [BR:cqu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    CpipJ_CPIJ012304
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    CpipJ_CPIJ012304
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     CpipJ_CPIJ012304
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2 PTCB-BRCT Lar_restr_allev
Other DBs
NCBI-ProteinID: EDS37185
VectorBase: CPIJ012304
UniProt: B0WYS5
AA seq 1000 aa
MDAHNLPFVSEYAKSGRASCKLCKDKIDKDELRLGAMVQSAFHDGKQAQWYHERCFFGKQ
RPTTEGDVAGFESLRFEDQKRIREKIASLGGGIVEATPTGKGKGKGKKRSAEQSNALKDF
GVEYAASGRAVCRGCEIKILKDEVRIKKVDYTTEVGMKYGGQALWHHAECFAKLRSELGY
FEKGEALPGYRNLKKEDMETVKRLLPAIKAEEVPAKKLKGEPKDEEETKQEAIDEALYAQ
QQKALFKIRDKLKDADIKKSEIHAILRANNQAIPEGVDACLMRVSDILTFGALKPCTKCG
GQFVLQKSAYICEGNLTEWVKCLTAEAKPARVPAIIPDEIKLQFRFLAKYKSVVSDRVIK
YVPPSLSTTMKKVKKEEELTEPKIKREKPPLYNLEFVILGKTETPKDQLKDKILKLGGKV
TTKITNTIAAIISTPAEVERMGSRMQEAKDMQIQVVPEDYIEDAKAGGAISYITSKSICD
WGSDPHSRIPQDEEKSKSKKSIYTKSVPSKVTLKLKGGLAVDPDSGLGEVAHVYKRDKVI
FNCVLNKVDIQTDKNSYFKMQVLEADKGNKYWVFRAWGRIGTTIGGNKLDKCGTVVEATN
LFYFHFDDKTGNSFDAHLNGSFSKRPGLYYPVDIDYSDEKTKKLSENNNIKSKLEPAVQD
LVRMLFDVDTMKKVMLEFELDMEKMPLGKLSQTQLQGAMKVLSEISNLIANGGSNPQFID
ASNRFYTFIPHNFGVQTPTVLDTVEQIKEKQTMLESLMEIEIAYSLLNADTDETKNPLDG
HYEQLKTEMQTLDQKSDEFKRLAQYVKNTHAATHNQFDLEVSEIFKIRRKGEERRYKPFR
KLHNRKLLWHGSRLTNFVGILTHGLKIAPPEAPVTGYMFGKGIYFADMVSKSANYCATSP
ANSTGLMLLCEVALGNMMELNQARYVQKLPDNMHSCKGVGKTQPNPAGAYVGPDGVEIPM
GTGVTDSKLQSALLYNEYIVYDVAQVNCQYLFKMNFKYKY
NT seq 3003 nt   +upstreamnt  +downstreamnt
atggacgcccataatctgccgttcgtgtccgagtacgccaagagtggccgcgcgtcctgt
aagctctgcaaggacaagatcgacaaagacgagctgcggctcggtgcgatggtccagtcg
gcgtttcacgacggcaagcaggcccaatggtaccacgagcggtgcttcttcggcaagcag
cggccgacgaccgaaggggatgtggccgggttcgagagtctgcgtttcgaggaccagaag
cggatcagggagaagattgcttccctcgggggtgggatcgtcgaggcaacgccgaccggc
aagggaaaggggaagggtaaaaagcggagcgccgagcagtcgaacgcgctgaaggacttt
ggcgtggagtacgccgcttcggggcgggccgtttgccgcgggtgtgagatcaagatcctg
aaggatgaggtgcgcatcaagaaggtggactacacgaccgaggtcggaatgaagtacggc
gggcaggcgctgtggcaccacgccgagtgctttgccaagctgcggtcggagctgggttat
ttcgagaagggcgaggcactgcccgggtatcgtaacctgaagaaggaggacatggagact
gtcaagcggttgctgccggcgatcaaagcggaggaagttccggccaagaagctcaagggc
gagccaaaggacgaagaggagacgaagcaagaggcgatcgatgaagcgttgtacgctcag
caacagaaggcgctcttcaagatccgggacaagctaaaggacgctgacatcaagaagtcg
gagatccacgcgattctgcgcgccaacaatcaagccattccggagggagtggacgcgtgt
ttgatgcgcgtgagcgacattctgaccttcggagcgctgaagccctgcaccaagtgcggt
ggccagttcgtgctgcaaaagtcggcctacatttgtgagggcaacctcaccgagtgggtc
aagtgcctgacggcggaggccaaaccagcgcgcgttccggccataattccggacgagatc
aagctacagtttcgcttcttggccaagtacaaatcggtggtgagcgatcgggtcatcaag
tacgtcccgccgagtctgagcaccacgatgaagaaggtcaagaaggaggaagagctgaca
gagccgaagatcaagcgcgagaagcccccactctacaacctggagtttgtcattcttggc
aagacggaaacgccgaaagatcagctcaaggacaagatcctgaagctgggcggcaaagtg
accaccaaaataaccaacacgatcgctgccatcatctcgaccccggcagaggtcgaacgg
atgggcagtcgcatgcaggaggccaaagatatgcagatccaggtcgtgccggaagattac
attgaggacgccaaggccggcggcgcgatctcgtacatcacgagtaagtccatctgcgac
tggggctcggatccgcacagccgaatcccgcaggacgaggaaaagtccaaatcgaagaag
agcatctacaccaaatccgtcccgtcgaaggtgacgctgaagctgaagggcggtctcgcg
gttgatcccgactccggcctaggcgaagtcgcgcacgtctacaagcgggacaaggtgatc
ttcaactgcgtgctcaacaaggtcgacattcagacggacaagaattcctacttcaagatg
caagtgctggaggcggacaagggcaacaagtactgggtgttccgcgcttggggccgcatc
ggaaccaccatcgggggcaacaagctggacaaatgcggcacggtcgtcgaagctacgaac
ctgttctacttccacttcgacgacaaaaccggcaactctttcgatgcgcacctcaacgga
agcttctccaagcgaccgggtctctactacccggtggacatcgattacagcgacgaaaag
accaagaaactgtccgagaacaacaacatcaaatcgaagctggaaccggcggtgcaggac
ctggtccgcatgctcttcgacgtcgacaccatgaagaaggtgatgctcgagttcgaactc
gacatggagaaaatgccgctcggaaaactctcccaaacgcagctgcaaggcgcgatgaag
gtcctctcagagatctccaacctgatcgccaacggtggatccaacccgcagttcatcgac
gcctccaaccgcttctacacgttcattccacacaactttggcgtccaaacgccgaccgtc
ctcgacaccgtcgagcagatcaaggaaaagcaaaccatgctcgaaagcctgatggagatc
gagatcgcgtacagtctgctgaacgccgacacggacgaaaccaaaaacccgctcgacggc
cactacgagcagctcaagacggagatgcaaacgctggaccaaaagtccgacgagttcaag
cgcctggcccagtacgtcaagaacacgcacgccgccacccacaaccagttcgacctggaa
gtgtccgaaatcttcaaaatccgccgcaagggcgaagagcgtcgctacaaaccgttccgc
aagcttcacaaccgcaaactcctctggcacggatcgcgtcttaccaactttgtcggtatt
ctcacgcacggtctcaagatcgccccgccggaggcccccgtcaccgggtacatgttcggc
aagggtatctacttcgccgacatggtgtccaaatccgccaactactgcgcaacctcgccg
gccaactcgaccggtttgatgctgctgtgcgaggtggccctcggtaacatgatggagctg
aaccaggcccggtacgtgcagaaactcccggacaacatgcacagctgcaagggtgtcggc
aaaacgcaacccaacccggccggcgcctacgtcggaccggacggcgtcgagatcccgatg
gggacgggcgtgaccgattccaagctgcagtcggcactgctatacaacgagtatatcgtg
tacgacgtggcccaggtcaactgccagtacctgttcaagatgaacttcaagtacaagtac
tag

DBGET integrated database retrieval system