KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012886
Entry
CpipJ_CPIJ012886  CDS       T01079                                 
Name
(GenBank) RING-box protein 1A
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
cqu04120  Ubiquitin mediated proteolysis
cqu04141  Protein processing in endoplasmic reticulum
cqu04310  Wnt signaling pathway
cqu04341  Hedgehog signaling pathway - fly
cqu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ012886
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ012886
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ012886
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CpipJ_CPIJ012886
   04341 Hedgehog signaling pathway - fly
    CpipJ_CPIJ012886
   04350 TGF-beta signaling pathway
    CpipJ_CPIJ012886
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ012886
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ012886
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     CpipJ_CPIJ012886
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   CpipJ_CPIJ012886
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     CpipJ_CPIJ012886
   Cul2 complex
     CpipJ_CPIJ012886
   Cul3 complex
     CpipJ_CPIJ012886
   Cul4 complex
     CpipJ_CPIJ012886
   Cul7 complex
     CpipJ_CPIJ012886
   Cul9 complex
     CpipJ_CPIJ012886
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      CpipJ_CPIJ012886
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      CpipJ_CPIJ012886
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 Hydant_A_C zf-RING_UBOX
Other DBs
NCBI-ProteinID: EDS38297
VectorBase: CPIJ012886
UniProt: B0X0Q5
AA seq 109 aa
MDVDEEEFEQPTSSSSRGERKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQAN
QASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 330 nt   +upstreamnt  +downstreamnt
atggacgtggacgaggaagagttcgagcagcccacttccagcagcagccgcggcgagcgg
aagcggttcgaggtgaagaagtggaacgccgtcgcactttgggcctgggacattgtggtg
gacaactgcgccatctgccggaaccacatcatggacctgtgcatcgagtgccaggcgaac
caggcatcggccacctcggaggagtgcaccgtggcctggggcgtctgcaaccacgcattc
cacttccactgcatctcgcggtggctcaagacccggcaggtgtgcccgctggacaacagg
gagtgggagttccagaagtacggacattaa

DBGET integrated database retrieval system